KEGG   Vulcanisaeta distributa: Vdis_0350Help
Entry
Vdis_0350         CDS       T01313                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_0350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_0350
   00620 Pyruvate metabolism
    Vdis_0350
   00640 Propanoate metabolism
    Vdis_0350
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_0350
   00680 Methane metabolism
    Vdis_0350
Enzymes [BR:vdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Vdis_0350
Lipid biosynthesis proteins [BR:vdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Vdis_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(347657..349549)
Genome map
AA seq 630 aa AA seqDB search
MAVNQKFYSLDKIRRMAIEASENPAKFWADKADYLTWFERPKSIFEGRAPDVYWFRGGYL
NISYNAVDRHIPARANKVAFYYENERGDSRVISYWDLYREVNRAAYVLKELGVKKGDTVS
MMMPNTPEAVYFGLAVHRLGATLVIHYAGLSEETLAYRLQDCGSKVFIVASKGFRAGDEV
RMKDLVDRTLEKYQTPVEKVLVVSRGFSDFNVKQGRDLVYEDIAPKGKVYVEPVPVEANE
PATIYYTSGTTGRPKGLWQSNGGYPIGLNWTFRALFNPQDTDVWWTISELGWPVWPMANL
YTIPVMGLTGLLFEGFVGYKRDLFARIVEKYRVSLIWSSTTTLYTIRSIGEDALKGDLSS
LRIILNTGETLNPGVAEWYIQQLPNTMIADAYWMTEHLIPIAATPYGLGEIPFKPGSAGI
QFPGSKWLVVDDDGNPLPPGQRGYIVIAIPNPAMAKMWNDPNHERLVKTYWSRFPGYFYT
GDYGFYDSDGYLYVLGRADDILTIAGERLGTMDIEGILARHKAVAEAAVVGAPAPGGGEK
VLAFVVLKSGEAPSEVLINDIKEFARASGTRVDDVIIVRRLPKTKSGKIMRRLLRALVKN
EPYGDISTLDDVRTLDDIKAALIERGYIKP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaaccaaaagttctattccttagataagataaggcgaatggctattgaggcc
tctgagaacccggccaaattctgggctgataaggctgattaccttacgtggtttgaaagg
ccgaagtcgatattcgagggcagggcgccggatgtttattggtttaggggtggttatcta
aacattagttataacgctgttgataggcacataccggctagggccaataaggtcgcgttt
tattatgagaatgagaggggcgatagtagggtcattagttattgggacctttacagggag
gttaatagggccgcgtatgtgctcaaggagcttggcgttaagaagggtgatacggtctcg
atgatgatgcccaacacgccagaggccgtttactttgggctcgccgtgcataggctcggc
gccacattggtaattcactacgctggtttaagtgaggagacccttgcatataggcttcag
gattgtgggtcgaaggtattcatagttgcatcgaagggatttagggctggtgatgaggtt
aggatgaaggatctcgtggataggacactcgagaagtaccaaacacctgttgagaaggtt
ctggttgtatccaggggattctctgacttcaatgttaaacagggtagagaccttgtctat
gaggatatagctccaaagggtaaggtctatgtcgagccagtccctgtggaggctaatgag
ccagccaccatatactacacgtcaggtactacgggtaggcccaaggggctttggcagagt
aatggtggttatccaataggccttaattggacatttagggcgttatttaacccacaggac
actgatgtttggtggacaataagtgagttggggtggcccgtgtggcccatggcgaatcta
tacacaatacccgtgatgggattaacaggcctcctgtttgagggattcgtgggttataag
agggacttatttgctagaattgttgagaagtaccgtgtttctttaatctggagtagtacg
accacgttatacacaattagaagcattggcgaggacgcacttaagggggacttgtcaagt
ctgaggataatactcaatacaggggagacgcttaacccaggcgttgctgagtggtatata
cagcaattgccaaataccatgatcgccgatgcctactggatgacggagcaccttatacca
attgccgcgacgccgtatggactcggcgagataccgtttaagcctggttcggctggtatt
caattcccaggtagtaagtggctggtggttgacgatgacggtaatccactgccgcctggg
cagaggggttacatagtcattgccattccaaacccggcaatggctaagatgtggaatgac
cccaatcacgagagattagtgaagacgtactggagtaggttcccagggtatttctataca
ggtgattatggcttctacgactcggatggttacctatacgtgctgggtagggctgatgat
atattgaccattgccggcgagagacttggtacaatggacatagagggtatcctagcaagg
cataaggcagtcgctgaggcggccgttgttggtgcaccggcgcctggtggtggcgagaag
gtactggccttcgtcgtacttaaatcaggggaggctccatcggaggtcctgataaacgat
attaaggagttcgccagggcgtcaggtactagggttgatgatgtaataatcgtaaggaga
ctaccgaagactaagtcgggtaagataatgaggaggttactaagggccttggtgaagaat
gagccgtatggggacatatcaacattagatgatgttaggactctagatgatataaaggcg
gcactaattgagcgtggttatataaagccgtga

DBGET integrated database retrieval system