KEGG   Vulcanisaeta distributa: Vdis_0368Help
Entry
Vdis_0368         CDS       T01313                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_0368
   01230 Biosynthesis of amino acids
    Vdis_0368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_0368
   00030 Pentose phosphate pathway
    Vdis_0368
   00051 Fructose and mannose metabolism
    Vdis_0368
   00052 Galactose metabolism
    Vdis_0368
  Energy metabolism
   00680 Methane metabolism
    Vdis_0368
Enzymes [BR:vdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Vdis_0368
Protein phosphatases and associated proteins [BR:vdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Vdis_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(363780..364784)
Genome map
AA seq 334 aa AA seqDB search
MKVGILTGGGDAPGLNIAVYTLTKLLEGKHEVYAIFHGWRGILDKEVRRVTSRDLIDFAF
EGGTFIRTSRTNPFKDETRAEVFARNLRELGLDVIVAIGGDDTLSAAAQTQARGLANVVG
IPKTIDNDVYGTDYTIGFDTAVNEAIKVTESFKTTLISHERVGVVEVMGREAGWIALFTG
LATMADFVLIPEKPVNWDIVANRVKEVYKDRRWALVVVSEGIKEYGGPKDEFGHSRLGGV
GNELAQYIEKVTGLETRAVIPGHIIRGAPPTAFDRVLAVRFATEAFNAIEDDDFGKMVAY
RGGDIVRVPITEVLGKNRLVSGYWIKLYETYWGP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggtatcctcacgggaggcggtgatgcaccgggacttaacatagccgtgtac
acgctgactaagttattagaggggaagcacgaggtttacgcaatattccatggctggagg
ggtatattggataaggaggttaggagggtcacgtctagggacctaatagatttcgcattc
gagggtggcacgttcattaggacatcaaggaccaacccatttaaggatgaaactagggct
gaggtctttgccagaaatttaagggagcttggtttagacgtgattgtggcgattggcggt
gacgatacgctgagcgcagcggcccagacccaggcaaggggtttagctaatgtggttggt
attccgaagacgatagacaatgatgtatatggcactgactacacaataggctttgacacg
gcggttaacgaggccattaaggtcactgaatccttcaagactacgttgatatcccatgag
agggttggtgttgttgaggtcatgggtagggaggccggttggatagccctattcactggt
ttagccacgatggcggacttcgtcctgatacccgagaagcctgttaactgggacatcgtt
gctaatagggttaaggaggtttacaaggataggaggtgggcgttggtcgtggtctccgag
ggtattaaggagtatggtgggcctaaggacgagtttggacactcgagacttggtggtgtt
ggtaatgaacttgcccagtatatagagaaggtcacgggtctcgagaccagggcagtgatt
ccaggccacattattaggggtgcaccaccaaccgcgtttgatagggtgttagccgttagg
ttcgccacggaggccttcaacgcgattgaggatgatgactttggtaagatggttgcttat
aggggtggtgacatagtcagggtgccaataacggaggtcctgggcaagaataggctggtt
agtggttattggataaagctttatgaaacatactggggaccttag

DBGET integrated database retrieval system