KEGG   Vulcanisaeta distributa: Vdis_0522Help
Entry
Vdis_0522         CDS       T01313                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00010  Glycolysis / Gluconeogenesis
vdi00020  Citrate cycle (TCA cycle)
vdi00620  Pyruvate metabolism
vdi00633  Nitrotoluene degradation
vdi00640  Propanoate metabolism
vdi00650  Butanoate metabolism
vdi00680  Methane metabolism
vdi00720  Carbon fixation pathways in prokaryotes
vdi01100  Metabolic pathways
vdi01120  Microbial metabolism in diverse environments
vdi01130  Biosynthesis of antibiotics
vdi01200  Carbon metabolism
Module
vdi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_0522
   00020 Citrate cycle (TCA cycle)
    Vdis_0522
   00620 Pyruvate metabolism
    Vdis_0522
   00640 Propanoate metabolism
    Vdis_0522
   00650 Butanoate metabolism
    Vdis_0522
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_0522
   00680 Methane metabolism
    Vdis_0522
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Vdis_0522
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Vdis_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_9 Fer4_16 Fer4_7 Fer4_17 Fer4_10 Fer4_2 Fer4_13 Fer4_8 Fer4_6 Fer4_4 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADN49920
JGI: Vdis_0522
UniProt: E1QUR7
Position
500597..501697
Genome map
AA seq 366 aa AA seqDB search
MSVQAPSIYTIEIIYRGIHQRHLARNLSRGIVYAARMAGNVALSYQRYGDDPERDGVPAK
YFVVVAKGANEEILDAEAARVEPDYVDVSIVLDDTILKGVESWAWQGIQPVHLKLRAGGL
LIVVSKRSPDELLKFIPTRDSPYTLVVVYGERSIGDFWTFPDDGTVERVLGAIAKVMPNV
LTIDDVKRYLESLDKPSERVNRALEAYQSLVKLREVKPGEGLPYKYEPPHLPGWKDMMIG
GAIPGLKPNQRNPYFTGGTAKHYRPVVNFDKCIKCSLCWEYCPDSVFDVTPDGYFNPVLA
YCKGCGVCAEVCPVPDTIIMVDEMEFEDGYGKFIDEYRAWKENREAYRKWFESLLPKAQI
ISVRKR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcaagctccaagtatatacacgatagagatcatctacaggggaatacaccag
aggcacctggcgaggaatctatccaggggaattgtttatgcggctaggatggcaggtaat
gtcgcattgtcttaccagagatatggtgatgatccagagagggatggtgtaccggctaag
tacttcgtggtagtggctaagggcgctaatgaggagattcttgatgctgaggctgcgagg
gttgagcctgactatgtggatgtctcgatagtgcttgacgacacaatacttaagggtgtt
gagtcctgggcttggcagggtattcaaccagtccacctgaagttgagggctggtgggtta
ttaatcgtggtttccaagaggagccctgatgaactactcaagttcatacctactagggac
tcaccgtataccctagtcgtggtttatggcgagaggagcattggcgatttctggacattc
ccagatgatggaactgtggagagggtccttggagccattgctaaggtaatgcccaacgta
cttaccattgacgatgttaagaggtatctggagagccttgataagcccagcgagagggtt
aacagggctttggaggcctatcaatcactcgttaagctaagggaggttaaacctggcgag
ggtctgccgtataagtacgaaccacctcacctacctggttggaaggacatgatgattggc
ggtgcaatacctggcttaaagccgaaccagaggaacccgtatttcaccggtggcactgcc
aagcattataggcctgtggtaaacttcgataaatgcattaagtgtagtctatgctgggag
tactgcccagactctgtatttgacgtaacaccagacggttacttcaacccagtactagcc
tattgcaagggttgtggagtgtgtgctgaggtatgcccagtgcctgacacgataattatg
gttgatgagatggagtttgaggatggctatggaaagttcattgatgagtatagggcttgg
aaggagaatagggaagcctataggaagtggtttgagtcattattaccaaaggcacaaata
ataagtgtgagaaagaggtga

DBGET integrated database retrieval system