KEGG   Vulcanisaeta distributa: Vdis_0524Help
Entry
Vdis_0524         CDS       T01313                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00010  Glycolysis / Gluconeogenesis
vdi00020  Citrate cycle (TCA cycle)
vdi00620  Pyruvate metabolism
vdi00633  Nitrotoluene degradation
vdi00640  Propanoate metabolism
vdi00650  Butanoate metabolism
vdi00680  Methane metabolism
vdi00720  Carbon fixation pathways in prokaryotes
vdi01100  Metabolic pathways
vdi01120  Microbial metabolism in diverse environments
vdi01130  Biosynthesis of antibiotics
vdi01200  Carbon metabolism
Module
vdi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_0524
   00020 Citrate cycle (TCA cycle)
    Vdis_0524
   00620 Pyruvate metabolism
    Vdis_0524
   00640 Propanoate metabolism
    Vdis_0524
   00650 Butanoate metabolism
    Vdis_0524
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_0524
   00680 Methane metabolism
    Vdis_0524
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Vdis_0524
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Vdis_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N DUF4992
Motif
Other DBs
NCBI-ProteinID: ADN49922
JGI: Vdis_0524
UniProt: E1QUR9
Position
503000..504022
Genome map
AA seq 340 aa AA seqDB search
MTISIKLARTVKDLLMMAQTEYFDAGHRTCQGCESAMVLRWVAKAAGPNTIVIGATGCMY
VANTTYYTTAWALPWIHTQLSGTGSAVVGTAAALKALIEKGKLPNEKINVIGICGDLGCA
DAGLSEVSNALTHTKYNFLILMYDNESSANTDIQETTMTPYGALTTFSPSGKQVRIMKYR
WKKNMAAMMAVGHPEVRYVATATAADPIDLYNKVKKALEIGGPTFIHTLDPCPKGWGYDP
KYSHEIGRLAVETGIWPLFEIEDGKFRLTSTSARIASGEIKRKPVKEYLRRQTRFKHLTD
EDIEYIQKKVDEMWEKWLIPGLIPLTRELPYPEVTKASTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatctctatcaagctcgctaggacagtcaaggacctcctaatgatggctcagaca
gagtatttcgatgcaggccataggacttgccagggctgtgaatcggcaatggtacttagg
tgggtagccaaggcagcaggccctaacacaattgtcattggggctacgggctgtatgtac
gttgctaacacgacctattacacaaccgcctgggcattaccctggatacacacccaatta
tccggcactgggtctgccgtagttggtacagcagcagcacttaaggcgctcatagagaag
ggcaaactacccaatgagaagattaacgtgataggcatatgcggcgacctgggctgcgca
gatgccggactttccgaggtttcaaatgcattaacacacactaagtacaatttcttaata
ctcatgtacgacaatgaatccagcgcaaacacagatattcaagaaacaacaatgacacca
tacggagccctaacaaccttcagcccaagcggtaagcaagtaagaataatgaagtatagg
tggaagaagaacatggccgcaatgatggctgtgggacacccggaggttaggtacgtggcc
acggcaacagccgcagacccaatagacctatacaacaaggtaaagaaggctttagagatt
ggtggacccactttcatacacacactagacccatgcccgaagggctggggttacgacccc
aagtacagccatgaaataggtaggctagcggtggagactggtatatggccactcttcgag
atagaggatggcaagttcaggttaacaagcactagcgctaggatagcaagtggcgaaatt
aagaggaagcccgttaaggagtacctgagaagacagacaaggtttaagcacctgaccgat
gaggatattgagtatatacagaagaaggttgatgagatgtgggagaagtggttaatacca
gggctaataccactaacaagggaattaccatatccagaagtcactaaggcatccactaaa
taa

DBGET integrated database retrieval system