KEGG   Vulcanisaeta distributa: Vdis_0534Help
Entry
Vdis_0534         CDS       T01313                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vdi  Vulcanisaeta distributa
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vdi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vdi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
515962..517152
Genome map
AA seq 396 aa AA seqDB search
MSELIRQVVNVLMDLIKVRTVALPGENYLEVVTYLDNLMTSYGLGTRIIKVPKSVVKEHY
PEFADYPRYILLAELCNVRDKRIHFNAHYDVVPGGSGWLVTEPFKPVLINGRVYGRGASD
DKGGVTALVLLAERLSELGEFHGCVEFSFTPDEEIGGESGVGYLINQIRKPDYAIVAEPT
GLDTVWIGSMGILQLDVIVRGVSSHASQPWYGTNAFEDGIKVAYALIKELKPKVESRQFM
GERATITLGGLARGGVSRNLVPDYFQFSIDRRILPSESIEHALNEIMSGIDNLRNNIKST
VEVHIVNKIEPAISKESTLLTKLMNAVKNVLGMNPKVTISRVPVDTRYLQNMGIDSLTYG
PGNVSSAHGPDEYINVSDIVNAVNVYTELIRNIYDK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactcataagacaggtagtcaatgtattgatggacttaattaaagtgaggacg
gtagcactgcctggcgaaaattacctagaggtagttacttacctggacaatttaatgact
agttatggattaggtacgagaattattaaggttcctaaatcagtcgttaaggagcattac
cccgaatttgcggattacccaaggtacatattactggctgagttgtgtaatgtcagggat
aagaggattcactttaatgcgcattatgacgtggtccctggaggaagtggttggttagta
acagaaccattcaagcccgtgctcatcaacggtagggtctatggtaggggcgcatctgat
gataagggtggcgtgacagccctagtactactggcagaacggcttagtgagttaggggag
tttcatggatgtgtagaattctccttcacacccgatgaggagattggcggtgaaagtggc
gttggctacttaattaaccagattcgtaagccggactacgcaattgttgccgagcccacg
ggacttgacaccgtgtggataggtagtatggggatactacaattagatgttattgtgaga
ggcgtatcaagccacgcctcacaaccgtggtatggaaccaacgccttcgaggatggcatt
aaggttgcttatgcattaattaaggagttgaagcctaaggttgagagtaggcaattcatg
ggtgagagagcaaccattactttgggagggcttgccaggggtggtgtttctcgtaatctc
gtacctgattactttcaattctcaatagacagaagaatactaccaagcgagagcatcgaa
cacgcgcttaacgaaataatgagcggcattgataatttacgtaacaacattaagtctacg
gtagaggtccacattgtgaataagattgaacccgcgataagcaaagaatcaacgctatta
acaaagcttatgaatgccgtgaaaaacgtactcggcatgaatcccaaggttacaatatct
agggttccagtggatacccgctacctacagaacatgggtattgactccctgacttacgga
cctggcaacgtatcatctgcgcacggccctgatgagtacattaatgtaagcgatatagtg
aacgcagtaaatgtctacacggaactaatcaggaatatctatgataagtag

DBGET integrated database retrieval system