KEGG   Vulcanisaeta distributa: Vdis_0606Help
Entry
Vdis_0606         CDS       T01313                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vdis_0606
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_0606
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Vdis_0606
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Vdis_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(583431..584654)
Genome map
AA seq 407 aa AA seqDB search
MRPRFLSKYILKCPRCGFETEASPYVMRCPRCGELLDALLIADRVRLNWGGLRGRGVWRY
RELLPEPGNTVTMGEGATPLIRLRGHGNAYVKFEGANPTGSFKDRGMTVGVSLALSIGVK
GVIVASTGNTAASAAAYAARAGLECLVVLPKGGVAKGKLGQAMLHGAKIAEVPGTFDNAL
EYVLEAVLSDGRVNNVNYYPLNSINPWRLEGQKTIAYEIVEEIGVPDYVFVPVGNGGNIY
AIWKGFRELVDFGVIDRVPKMIGVQASGAAPMVRYWRGLGEARIDNPRTVASAIRIGRPI
NWFRAYRAVKYSGGEFIEVSDDEILMAQRMLGREGIGVEPASAASLAGYLKALGEGMVDA
GDKVVLIATGHALKDPDTLLMNSNVNMVSVSSLDELRSLIVAQEPGI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagacctagattcctcagtaaatacatcctaaagtgtccaaggtgtggtttcgagacc
gaggcgagcccatacgtaatgaggtgcccaaggtgtggtgaattacttgatgcattatta
atcgctgatagggttaggttgaactggggaggtttacggggtaggggtgtatggaggtat
agggaattactgcctgagccgggtaataccgtcacgatgggcgagggcgcaacgccatta
attaggttaagaggtcatggcaatgcctatgtcaagtttgagggtgcaaacccaacgggc
tcctttaaggatagggggatgactgtcggcgtttcattggcgttgtcaataggtgttaag
ggggttatagtggcgtcaacggggaatactgcggcgtccgcggcggcctacgcggctagg
gcaggccttgagtgcctagtggttctaccaaagggtggtgttgccaagggcaagttgggg
caggcgatgctgcatggtgcgaagatcgccgaggttcctggcacatttgataatgcgttg
gagtacgtattagaggctgtattgagtgatggccgtgtcaacaacgttaattactaccca
cttaattcgataaatccctggaggttggaggggcagaagaccatagcctatgaaattgtg
gaggagattggtgtcccggattacgtctttgtcccggtgggtaatggtggcaatatatac
gccatttggaaggggtttagggagttggtggattttggcgtgattgatcgcgtaccgaaa
atgattggtgtccaagcatcaggggctgcgccgatggttaggtattggaggggcttgggt
gaggcgaggattgataacccaaggactgtggcctcggcaataaggattggtaggccaatt
aattggtttagggcttatagggctgttaagtatagtggtggtgaattcattgaggttagt
gatgatgagatattaatggctcagagaatgcttggtagggagggcatcggcgtcgaacct
gccagcgcggcatcactggctggttacttaaaggctttgggtgagggcatggttgacgct
ggggataaggtagtattaatagccaccggccacgcactaaaggatccagacacactacta
atgaatagtaatgtgaatatggttagtgtctcgtcattggatgagttgaggtccctaata
gttgcccaggaaccaggaatatag

DBGET integrated database retrieval system