KEGG   Vulcanisaeta distributa: Vdis_0688Help
Entry
Vdis_0688         CDS       T01313                                 

Definition
ketol-acid reductoisomerase (EC:1.1.1.86)
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
vdi  Vulcanisaeta distributa
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Vdis_0688
   01230 Biosynthesis of amino acids
    Vdis_0688
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Vdis_0688
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Vdis_0688
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     Vdis_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
670328..671311
Genome map
AA seq 327 aa AA seqDB search
MARIYKDGDADLSVIRGKVVAVLGYGIQGRAWALNMRDSGVKVIVGVRPGKSFDLARQEG
FEVYPVGDAVRRADIIAVLLPDMVQPSVWGSEIAPGLRRGMTVVFAHGFNIRFGLIRPPS
DVDVVLIAPKAPGKAVRDEFVRGWGVPALVAVHQDFTGSALKTALAIAKANGFTRVGVIE
TTFAEETETDLIGEQNVLVGGLLQLLRYGFEVMVELGYQPEVAYFEAINEAKLIMDLIWE
RGLTGMLLGVSETARYGGLTVGPYVINEDVKRRMKEAAEKVRSGEFAKEWIAEYQRGAPR
LRELLEQVSNSQVERVGEFLRQLMRSK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctaggatatacaaagatggggatgcggatctatcggtgataaggggtaaggtagtg
gctgtgcttggttacggcattcagggtagggcgtgggccttaaacatgagggatagtggt
gtcaaggtcattgttggcgtcaggcctggcaagagctttgacctggctcggcaggagggc
tttgaggtctacccagtgggtgatgcggttaggagggccgacataatagcggtcctacta
cccgatatggtacagccaagtgtttgggggtctgagatcgcgccgggccttaggcgtggc
atgactgtggtgtttgcccatggcttcaacattaggtttgggttaataaggccgccaagt
gatgtggacgtagtcctaatagcgcccaaagccccaggtaaggccgttagggatgagttc
gttaggggttggggagtcccggcactcgtcgcagttcaccaggacttcacggggagtgcc
ctgaagacggcattggcgattgccaaggccaatgggttcacgagagtgggtgtaatagag
acgaccttcgccgaggagacggagaccgacctaatcggtgagcagaacgtgcttgttggc
gggctactgcagttgttgaggtatggttttgaggttatggtggagctcggttaccaacct
gaggtggcttacttcgaggccattaatgaggctaagctaataatggacctgatatgggag
aggggactcactgggatgcttctaggtgttagtgagactgccaggtacggtggcttgacg
gttgggccgtacgtaattaatgaggatgttaagaggaggatgaaggaggctgccgagaag
gttagaagtggcgaatttgctaaggagtggattgcggagtatcagaggggtgcgccaagg
ctcagggagttacttgagcaggttagtaatagccaggttgagagggttggcgagttccta
aggcagttaatgagaagcaagtaa

DBGET integrated database retrieval system