KEGG   Vulcanisaeta distributa: Vdis_1097Help
Entry
Vdis_1097         CDS       T01313                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vdi  Vulcanisaeta distributa
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_1097
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vdis_1097
   00640 Propanoate metabolism
    Vdis_1097
   00660 C5-Branched dibasic acid metabolism
    Vdis_1097
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_1097
Enzymes [BR:vdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Vdis_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1042809..1043933)
Genome map
AA seq 374 aa AA seqDB search
MRLLEYKGKELLNKYGVKIPRGAIVKSLNDIDILNTLKFPLFAKAQVPFAGRAKMGLVRR
VNTIKDAENAARDYLGKVIQDYPIRKVLFEEGVNVAKELYISITLDRENRGYLMLASTEG
GIDIEEVARRSPEKIIRLYIDDYEGLRDYMIRGVAQKLGLEGSAAQDFVTVAKAMYRVFT
EYDAELVEINPLALTTDGQLVALDVKVMIDDNSLYRHPDISIEDSDYTTEELEARKYGLH
YVELTGYVGIMANGAGLTMATMDLVKEFGHEPADFLDVGGGASKDAVREGLKMLLTDDRI
KAVLINIFGGITRCDEVAKGVVEALNEVKTNKPIFIRLKGTNEEEGRRILAEIGLKTYET
AEEAMGALSKAIAR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctcctcgagtataagggtaaggagttgctgaataagtatggcgttaagataccc
aggggcgccatagtcaagagccttaatgacatagacatactcaacacactcaaattcccg
ctgttcgccaaggcccaggtacccttcgcaggcagggctaagatggggctcgtcaggagg
gttaacaccattaaggatgctgagaacgccgcgagggattacctgggtaaggtgattcag
gattacccaattaggaaggtgctatttgaggagggcgttaatgtggctaaggagctttac
atatccataaccctggacagggagaacaggggctacctaatgcttgcatccacggagggc
ggtatcgacattgaggaggtggccaggagaagccctgagaagataattaggctttacata
gatgattatgagggacttagggactacatgattaggggagttgctcagaagcttggtttg
gagggttctgcagcccaggacttcgtaaccgtggctaaggccatgtacagggtatttact
gagtatgatgccgagcttgtggaaataaatccacttgcactaacaactgatgggcagttg
gtggctctggacgttaaggtcatgattgatgataactcactttataggcacccagacatt
agtattgaggatagtgattacacgaccgaggagcttgaggctaggaagtacgggctacat
tacgtggagttgacgggctacgtggggatcatggccaacggcgctggcttaacaatggca
accatggacttggttaaggagttcggtcatgaacctgccgacttccttgacgttggtggt
ggagctagtaaggatgctgtgagggagggattgaaaatgctgttaacagacgacaggata
aaggctgttttgataaacatatttggcggtataacgaggtgtgacgaggttgccaagggc
gttgttgaggcgttgaatgaggttaagaccaacaagccaatcttcattaggttgaagggt
actaacgaggaggagggtaggagaatactggctgagatagggcttaaaacctatgaaact
gctgaggaggcaatgggagctttgtcaaaggcaattgcgaggtga

DBGET integrated database retrieval system