KEGG   Vulcanisaeta distributa: Vdis_1104Help
Entry
Vdis_1104         CDS       T01313                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vdi  Vulcanisaeta distributa
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Vdis_1104
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vdis_1104
Enzymes [BR:vdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Vdis_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1050496..1051488
Genome map
AA seq 330 aa AA seqDB search
MYSTHFFEETFIKLAVDVLVGSLTWFNRDVISVLDFNREDFEVLFSEALNMEKYAKSRLD
ILSDKVLALAFFEPSTRTRLSFETAMLRLGGRVIGFSGVEATSMAKGENLADTIRMLDAY
ANAIVIRHSLEGAAKFAAEIAESPVINAGDGSQNHPTQAMLDLYTIWREFKVIDGLSIGI
LGDLRYARVVNSLVQALSYYRVRLHLISPELLRPRQELIEFMNSRGMKYDWTDDPYNVIN
DLDVLYVVRIQRERFPDPMEYEKVKGAYKVTPKLIEKGKPNLIILHPLPRVDEVDFAVDN
MPQAKYFKQASLGVPLRMALLKLVLAGDKS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgtattccacccactttttcgaagaaacctttattaaattagctgttgacgtcttggtg
ggttccttgacctggtttaatcgggatgtcataagcgtgctggatttcaatagggaggac
tttgaggttttgttttctgaggcccttaatatggaaaagtatgctaagtctagactcgat
atcctcagtgataaggtccttgccctggcattcttcgagccgagcactaggactaggctt
agctttgagactgccatgcttaggcttggtggcagggtaataggctttagcggtgttgag
gctacgtcgatggctaagggcgagaatctcgccgacacaattaggatgcttgatgcttat
gcaaacgccatagtgattaggcacagccttgagggcgcggcaaaattcgcggctgagatt
gcggagtcgccagtgattaatgcaggtgatggctctcagaaccacccgacccaggcaatg
cttgacctatacacgatttggcgggagtttaaggtgattgatggcctatccatcgggata
ctcggcgaccttaggtatgccagggtcgttaactcactggttcaggccctgtcctattac
agggttaggcttcacctaatatcgcctgaactgctaaggcctaggcaggagcttattgag
ttcatgaattcaaggggcatgaaatatgactggactgatgatccgtataacgtgattaat
gatttagacgtgctgtatgtcgtcaggattcagagggagaggttccctgacccgatggag
tacgagaaggttaaaggcgcctacaaggtaacgcccaagttaatcgagaagggcaagcca
aacctaataattcttcacccattgcccagggttgatgaggttgactttgcggttgataat
atgccgcaggctaaatacttcaaacaagccagcctaggggttcccctgcgcatggccttg
ttaaaactcgtgcttgctggtgataaatcatga

DBGET integrated database retrieval system