KEGG   Vulcanisaeta distributa: Vdis_1224Help
Entry
Vdis_1224         CDS       T01313                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vdi  Vulcanisaeta distributa
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Vdis_1224
Enzymes [BR:vdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Vdis_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1166187..1167101)
Genome map
AA seq 304 aa AA seqDB search
MSNNEDKFDLMIISDCVLDIYYRVRELPIKAGDVAVSDIIALSPGGACTTAIVARKLGLK
VAVIDRVGGDPFSDILIKYLNDVGVHTGFIKRVRGFVTISNNIIGADDHAFMGYLGVGKE
LTIDDINENIIRNSRAVFINGFYASFTRDIIKVFAEVIRIARKYSVPIFLDTGPSINNID
LMINLIKSVSTVFMNEKEMRRLFGDINGLANTTRGTDVIAVVKLGSKGAALVHNGVIHQC
QPYNVSNAVTTIGAGDTFDAAYMAGIMHGLSPMNSCDLGNRIAALRIQYLTPIELHNLEG
LITW
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataatgaggataaatttgacctaatgataatctctgactgcgtcttagatatt
tattatagggttagggaattacctattaaggctggtgacgttgccgtatccgatataatt
gccctatcacccggcggtgcatgcacaacagctatagtagcccgtaaactaggccttaag
gtcgcagtcattgatagggttggtggtgacccattctccgacatactcattaagtacctt
aatgacgtcggcgtgcacacgggatttataaaaagggtgcgtggtttcgtaacaatatcc
aataatataattggcgctgatgaccacgcattcatgggttacctaggcgttggtaaggaa
ctaacgatagatgatattaatgagaatattatcaggaattcgagggctgtatttatcaat
ggcttctatgcctcatttacgagagacattatcaaagtattcgcagaggtaattagaatt
gcccgtaagtactcagtccctatattcctcgatacgggaccctccattaataacatagac
ctcatgattaacctcattaagtcagtaagtactgtctttatgaatgagaaggagatgagg
aggttatttggtgatataaatggtttagccaacaccacacgtggtactgacgttattgcc
gtagtgaagctaggcagtaagggcgccgccctggtacataatggagtaattcatcaatgc
caaccttataacgtgagtaatgcagtgacaacaataggcgctggtgatacatttgatgct
gcctacatggctggcatcatgcatggtctgagtcccatgaattcctgcgatttaggcaat
aggattgctgcattaagaattcaatacctaacgccaatcgagctacacaacctcgagggt
ctcattacgtggtaa

DBGET integrated database retrieval system