KEGG   Vulcanisaeta distributa: Vdis_1254Help
Entry
Vdis_1254         CDS       T01313                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_1254
   01230 Biosynthesis of amino acids
    Vdis_1254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1254
   00051 Fructose and mannose metabolism
    Vdis_1254
   00562 Inositol phosphate metabolism
    Vdis_1254
Enzymes [BR:vdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Vdis_1254
Exosome [BR:vdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Vdis_1254
  Exosomal proteins of bladder cancer cells
   Vdis_1254
  Exosomal proteins of melanoma cells
   Vdis_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1192234..1192905
Genome map
AA seq 223 aa AA seqDB search
MKLPILIINMKVYPEVLGKRALELAKVAEAVSRELGVSIAVAPPITELRLVAENVGIPVY
AQGADPVEPGARTGHVPPEFIKEAGASGVILNHSENRLLLNDLGWLVNRAKNLGLETLVC
APDPYTSAAAAALEPTAVAVEPPELIGTGKAVSREKPDVIVKTVELVKRVNPSIPVITGA
GIESYEDVKRAVELGTQGVLVASAIVKARDWRQKIMELAKALH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaccaatattaatcataaacatgaaagtgtaccctgaggtgctcggtaagagg
gctcttgagcttgctaaggtcgctgaagctgtgtccagggagttaggtgtgtccattgcc
gttgccccaccaattactgagcttaggcttgtggctgagaacgtgggaatacccgtgtat
gcccagggtgctgatccagttgagcctggggctaggacagggcatgtaccgcctgagttc
attaaggaggccggggcgtcgggagtaatacttaatcacagcgagaataggctcctccta
aatgaccttggctggctcgttaacagggcgaagaacctcggcctagagactctcgtgtgt
gcgccggacccatacacgagcgcggctgccgctgcccttgagccaacggcagtagcagtt
gagccacccgagcttattggcactggtaaggccgtaagtagggagaagcctgacgtcatt
gtgaaaaccgtggaactcgttaaaagagttaacccgagcattccggtcatcacgggggcc
ggtattgagagctatgaggatgttaaaagggccgttgaacttgggacacagggagtcctg
gtagctagtgccattgttaaggcgagggattggagacagaagattatggagttagccaaa
gcattacattaa

DBGET integrated database retrieval system