KEGG   Vulcanisaeta distributa: Vdis_1389Help
Entry
Vdis_1389         CDS       T01313                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vdi  Vulcanisaeta distributa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vdis_1389
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Vdis_1389
Exosome [BR:vdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vdis_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1319372..1320424
Genome map
AA seq 350 aa AA seqDB search
MVVTESIRLRNYLFNYPVNRPRRLRSNVLIRNMVAETMLRPDDFVMPIFVREDINEPEPI
KSLPGQYRWPLNDKLINFVDQLVSSGIRSVILFGIPEHKDEWGSSAYDEHGIIQRTIKFL
KDSFEDKLIVMADVCLCEYTDHGHCGVVKKLPDGRYIVDNDSTIELYAKTAVTYAESGVD
VVAPSGMMDGQVKAIREALDRAGFNDVVIMAYSAKYASSFYGPFREAAASAPKFGDRRSY
QMDPRNAHEALKEVAMDINEGADIVMVKPAMLYLDVIRLVKQNFPEVPLAAYQVSGEYAM
LKAAIMNGWLDEKRAILESLIAIRRAGADLIITYFAKDVVNYLDEIERLF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggttgttactgaaagtattaggttgaggaattacctgtttaattatcccgttaatagg
cccaggaggcttaggtcgaatgtgctcattaggaatatggttgctgagactatgctcagg
cctgatgacttcgtaatgcccatattcgtcagggaggatattaatgaacctgaacccatt
aagtcattgcctggacagtacaggtggccccttaatgataagttgatcaacttcgttgat
cagttggttagttctggcattaggtcggttattttatttggcatacctgagcataaggat
gagtggggtagttcggcgtacgatgagcatggcataatacagaggacgattaagttcctt
aaggactcctttgaggataaactcattgtaatggctgacgtatgcctatgcgagtacacg
gatcatggccactgcggtgttgttaagaaattgcctgatggcaggtatatagttgataat
gactcaacaatagagctctacgccaagaccgcagtgacatacgcggagtctggtgttgat
gttgttgcgccgtccggcatgatggatgggcaggttaaggcaattagggaagcccttgac
agggccggctttaatgacgttgtcataatggcttacagcgctaagtacgcgagttcgttc
tacggtccgttcagggaggccgcagccagtgcgcctaagtttggtgataggcgtagttat
cagatggacccgaggaatgcgcacgaggcccttaaggaggttgccatggacattaatgag
ggtgctgacatagtcatggttaaaccagcaatgctttatcttgatgttattaggcttgtg
aagcagaactttcctgaggttccgttggccgcctaccaggtcagtggtgagtatgcaatg
cttaaggctgctataatgaatggttggcttgatgagaagagggcaattcttgagtcttta
attgccattaggagggctggagcagatttaataatcacgtacttcgcaaaggatgttgtt
aattatctcgatgaaattgagagactcttctga

DBGET integrated database retrieval system