KEGG   Vulcanisaeta distributa: Vdis_1460Help
Entry
Vdis_1460         CDS       T01313                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K19590  
D-arabinose 1-dehydrogenase [EC:1.1.1.117]
Organism
vdi  Vulcanisaeta distributa
Brite
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.117  D-arabinose 1-dehydrogenase [NAD(P)+]
     Vdis_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1389136..1390167)
Genome map
AA seq 343 aa AA seqDB search
MKVKAAILQEFSKPLRLGYVDIPEPGDDESVLVRIVGAGMCKTDVRLWRGEEPREGFKTP
FVLGHENAGVVEAVGKRVKGLNPGDKVLVYAIWADLNCKYCRVDKCMQCRGHAIPGQSYY
YGGYAEYLYVPNYRYLVKIDIDPVEAAPLADAGLTSYSAVKKALPYLRPDSLVIVYGVGG
LASYAIQYLKHLAPYVKIIAVSRSDNKLKWAMELGAHYAVHPSEVNKVIRDLNPDGVAVM
LDFVGNDESAKMIPLLEPGGAVILVGMEGKSYPIPVFETTVWQYIVIGSNYGSISEMEEM
VKFVKEHGIRSYIEKVPLEENAINNALNRLAEGKVLGRFVITP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgaaagcagcaatacttcaggagttcagcaaaccattaaggttggggtacgta
gatattcctgaacccggtgatgatgaatcggtactcgttagaatagtaggtgctggtatg
tgtaagacagacgtaagattatggagaggtgaggagcctagagagggatttaaaacgcct
tttgttctcggtcatgaaaatgcgggtgttgttgaggccgttggtaaaagagttaagggg
ttaaatcctggtgataaggtccttgtttacgcgatatgggcagacttgaattgtaagtat
tgccgtgttgataaatgtatgcaatgtagaggtcatgctattccaggccaatcgtattat
tatggcggctatgcagagtatctatatgtacctaattatagatacttagttaagatagat
attgacccggtagaggccgcaccattagctgatgcaggtttaacttcatactcggctgtt
aaaaaggcattgccttatttaagaccggactcgctggttattgtctacggcgttggtgga
ttagcgtcgtacgctattcaataccttaagcacttagcaccttatgtaaaaataatagca
gtttctagaagtgataataaacttaaatgggccatggaattaggagctcactacgcagta
catccaagtgaagttaataaagtgatcagggatttgaatccggacggtgtagccgtaatg
ctcgactttgtgggcaatgatgaatccgcaaaaatgattcccttattggaaccaggcggc
gccgttatactagtcggtatggagggtaagtcctatccgatacctgtgtttgaaactaca
gtttggcaatatatagttattggtagtaattatggctccataagtgagatggaggagatg
gttaaattcgtgaaggaacatggaataaggtcttacatagagaaggtgcctctcgaagag
aatgccattaacaacgctttaaataggctagcggagggtaaagtactaggtagatttgta
ataacaccgtag

DBGET integrated database retrieval system