KEGG   Vulcanisaeta distributa: Vdis_1460Help
Entry
Vdis_1460         CDS       T01313                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Vdis_1460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1460
  Lipid metabolism
   00071 Fatty acid degradation
    Vdis_1460
  Amino acid metabolism
   00350 Tyrosine metabolism
    Vdis_1460
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Vdis_1460
   00626 Naphthalene degradation
    Vdis_1460
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Vdis_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1389136..1390167)
Genome map
AA seq 343 aa AA seqDB search
MKVKAAILQEFSKPLRLGYVDIPEPGDDESVLVRIVGAGMCKTDVRLWRGEEPREGFKTP
FVLGHENAGVVEAVGKRVKGLNPGDKVLVYAIWADLNCKYCRVDKCMQCRGHAIPGQSYY
YGGYAEYLYVPNYRYLVKIDIDPVEAAPLADAGLTSYSAVKKALPYLRPDSLVIVYGVGG
LASYAIQYLKHLAPYVKIIAVSRSDNKLKWAMELGAHYAVHPSEVNKVIRDLNPDGVAVM
LDFVGNDESAKMIPLLEPGGAVILVGMEGKSYPIPVFETTVWQYIVIGSNYGSISEMEEM
VKFVKEHGIRSYIEKVPLEENAINNALNRLAEGKVLGRFVITP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgaaagcagcaatacttcaggagttcagcaaaccattaaggttggggtacgta
gatattcctgaacccggtgatgatgaatcggtactcgttagaatagtaggtgctggtatg
tgtaagacagacgtaagattatggagaggtgaggagcctagagagggatttaaaacgcct
tttgttctcggtcatgaaaatgcgggtgttgttgaggccgttggtaaaagagttaagggg
ttaaatcctggtgataaggtccttgtttacgcgatatgggcagacttgaattgtaagtat
tgccgtgttgataaatgtatgcaatgtagaggtcatgctattccaggccaatcgtattat
tatggcggctatgcagagtatctatatgtacctaattatagatacttagttaagatagat
attgacccggtagaggccgcaccattagctgatgcaggtttaacttcatactcggctgtt
aaaaaggcattgccttatttaagaccggactcgctggttattgtctacggcgttggtgga
ttagcgtcgtacgctattcaataccttaagcacttagcaccttatgtaaaaataatagca
gtttctagaagtgataataaacttaaatgggccatggaattaggagctcactacgcagta
catccaagtgaagttaataaagtgatcagggatttgaatccggacggtgtagccgtaatg
ctcgactttgtgggcaatgatgaatccgcaaaaatgattcccttattggaaccaggcggc
gccgttatactagtcggtatggagggtaagtcctatccgatacctgtgtttgaaactaca
gtttggcaatatatagttattggtagtaattatggctccataagtgagatggaggagatg
gttaaattcgtgaaggaacatggaataaggtcttacatagagaaggtgcctctcgaagag
aatgccattaacaacgctttaaataggctagcggagggtaaagtactaggtagatttgta
ataacaccgtag

DBGET integrated database retrieval system