KEGG   Vulcanisaeta distributa: Vdis_1496Help
Entry
Vdis_1496         CDS       T01313                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Vdis_1496
Enzymes [BR:vdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Vdis_1496
Exosome [BR:vdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vdis_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1418597..1420171
Genome map
AA seq 524 aa AA seqDB search
MAHEKEFILVIDQGTTGTRAVLISRNGSIMGYAYHEHTQIYPRPAWVEHNPLEIWEKTKL
VIKEVLEYTRVDPRKIAAIGVTNQRETTVIWDPRNGQPVYNAIVWQDRRTSSMVDYLKQN
YLGVIQERTGLVPDAYFSGSKIWWLLDNVPGLRDRARKGEVVFGTIDTWLIWNLTRGNKD
VLTPERGGAHVTDYSNASRTMIFNIHRLDWDDELLEIEGKIPRDILPLPRPSSDRRIYGY
TGPEVSQLLGGVSIPVCGDAGDQQAALFGQVGFDVGEVKSTYGTGNFILMNIGDTPVRSK
ANLLTTIYYSIEEGKAKYALEGSIFITGAAVQWLRDGLKIIEVSDEIEPLAASANDTGGV
YFVPAFTGLGAPYWDQYARGLIIGITRGTERKHIARAVLEAIAYLNRDVLEAMMSDTGIR
IPRIKVDGGAARNNFLMQFQADITGIEVWRPVIFETTSLGAGYLAGLAVGLWKSLDEIAR
NWKLDRVFKPRMDLETRERLYRGWRAAVQRALGWAKEVPWAYGL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgagaaggagtttatcctcgttattgaccagggaaccactggtacgagggct
gtattgatttcgaggaatggctcaataatggggtatgcatatcatgagcacacgcagatt
tatcctaggcctgcgtgggttgagcataacccactggagatttgggagaagactaagctc
gtgattaaggaggtccttgagtatactagggttgatccgaggaaaatagcggctattgga
gttactaatcagcgtgagaccacagttatttgggatccgaggaatggtcaaccggtctat
aacgccattgtttggcaggacagaagaacatcatctatggttgattacctgaagcagaat
tacctgggtgtgattcaggagaggacaggcctcgttccagacgcctatttctctgggtca
aagatttggtggctccttgataatgtaccagggctcagggatagggctaggaaaggtgag
gtggtctttggcactatcgatacctggttaatttggaacttaaccagaggtaataaggac
gtgctaacgcccgagaggggtggtgcccacgtcactgactacagtaatgcgtctaggacc
atgatattcaatattcacaggcttgactgggatgatgaactgcttgagattgagggtaag
atacccagggacatactgcccttaccaaggccatcaagtgataggaggatatacggctat
acaggccctgaagtttcccaactacttggtggcgtaagtatcccagtctgtggtgatgct
ggtgatcagcaagcggcattgtttgggcaggttggtttcgatgttggcgaggttaagtca
acatacggtactggtaatttcatactaatgaatatcggggacacaccagtaagatctaag
gcaaatctattaaccactatttactactccattgaggagggtaaggctaagtacgcactt
gagggtagcatatttatcactggggctgctgtgcagtggttgagggatggccttaagata
atagaggtttccgacgagatagagccattggccgcatcagctaacgatacaggcggtgtt
tacttcgtgccagccttcacggggctcggtgcgccgtattgggatcagtatgcccgtggg
cttataataggcattacacgtggtacagagagaaagcacattgccagggctgtccttgag
gcgatagcgtacctaaacagggatgttcttgaggccatgatgagcgatacggggattagg
atacctaggattaaggttgatggcggtgctgctaggaataacttcctaatgcagttccaa
gctgacataacgggtattgaagtctggaggccggtgatctttgaaacaacatcgctaggc
gcaggctatctagcaggtttagcagttggtctttggaagagtttagatgaaattgccagg
aactggaaattggacagggtatttaagccaaggatggacttggaaacgagggagcgttta
tataggggttggagggcagccgtacaaagagccttgggctgggctaaggaagttccgtgg
gcttatggattatag

DBGET integrated database retrieval system