KEGG   Vulcanisaeta distributa: Vdis_1496Help
Entry
Vdis_1496         CDS       T01313                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vdi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1418597..1420171
Genome map
AA seq 524 aa AA seqDB search
MAHEKEFILVIDQGTTGTRAVLISRNGSIMGYAYHEHTQIYPRPAWVEHNPLEIWEKTKL
VIKEVLEYTRVDPRKIAAIGVTNQRETTVIWDPRNGQPVYNAIVWQDRRTSSMVDYLKQN
YLGVIQERTGLVPDAYFSGSKIWWLLDNVPGLRDRARKGEVVFGTIDTWLIWNLTRGNKD
VLTPERGGAHVTDYSNASRTMIFNIHRLDWDDELLEIEGKIPRDILPLPRPSSDRRIYGY
TGPEVSQLLGGVSIPVCGDAGDQQAALFGQVGFDVGEVKSTYGTGNFILMNIGDTPVRSK
ANLLTTIYYSIEEGKAKYALEGSIFITGAAVQWLRDGLKIIEVSDEIEPLAASANDTGGV
YFVPAFTGLGAPYWDQYARGLIIGITRGTERKHIARAVLEAIAYLNRDVLEAMMSDTGIR
IPRIKVDGGAARNNFLMQFQADITGIEVWRPVIFETTSLGAGYLAGLAVGLWKSLDEIAR
NWKLDRVFKPRMDLETRERLYRGWRAAVQRALGWAKEVPWAYGL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgagaaggagtttatcctcgttattgaccagggaaccactggtacgagggct
gtattgatttcgaggaatggctcaataatggggtatgcatatcatgagcacacgcagatt
tatcctaggcctgcgtgggttgagcataacccactggagatttgggagaagactaagctc
gtgattaaggaggtccttgagtatactagggttgatccgaggaaaatagcggctattgga
gttactaatcagcgtgagaccacagttatttgggatccgaggaatggtcaaccggtctat
aacgccattgtttggcaggacagaagaacatcatctatggttgattacctgaagcagaat
tacctgggtgtgattcaggagaggacaggcctcgttccagacgcctatttctctgggtca
aagatttggtggctccttgataatgtaccagggctcagggatagggctaggaaaggtgag
gtggtctttggcactatcgatacctggttaatttggaacttaaccagaggtaataaggac
gtgctaacgcccgagaggggtggtgcccacgtcactgactacagtaatgcgtctaggacc
atgatattcaatattcacaggcttgactgggatgatgaactgcttgagattgagggtaag
atacccagggacatactgcccttaccaaggccatcaagtgataggaggatatacggctat
acaggccctgaagtttcccaactacttggtggcgtaagtatcccagtctgtggtgatgct
ggtgatcagcaagcggcattgtttgggcaggttggtttcgatgttggcgaggttaagtca
acatacggtactggtaatttcatactaatgaatatcggggacacaccagtaagatctaag
gcaaatctattaaccactatttactactccattgaggagggtaaggctaagtacgcactt
gagggtagcatatttatcactggggctgctgtgcagtggttgagggatggccttaagata
atagaggtttccgacgagatagagccattggccgcatcagctaacgatacaggcggtgtt
tacttcgtgccagccttcacggggctcggtgcgccgtattgggatcagtatgcccgtggg
cttataataggcattacacgtggtacagagagaaagcacattgccagggctgtccttgag
gcgatagcgtacctaaacagggatgttcttgaggccatgatgagcgatacggggattagg
atacctaggattaaggttgatggcggtgctgctaggaataacttcctaatgcagttccaa
gctgacataacgggtattgaagtctggaggccggtgatctttgaaacaacatcgctaggc
gcaggctatctagcaggtttagcagttggtctttggaagagtttagatgaaattgccagg
aactggaaattggacagggtatttaagccaaggatggacttggaaacgagggagcgttta
tataggggttggagggcagccgtacaaagagccttgggctgggctaaggaagttccgtgg
gcttatggattatag

DBGET integrated database retrieval system