KEGG   Vulcanisaeta distributa: Vdis_1639Help
Entry
Vdis_1639         CDS       T01313                                 

Definition
fructose-bisphosphate aldolase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_1639
   01230 Biosynthesis of amino acids
    Vdis_1639
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1639
   00030 Pentose phosphate pathway
    Vdis_1639
   00051 Fructose and mannose metabolism
    Vdis_1639
  Energy metabolism
   00680 Methane metabolism
    Vdis_1639
Enzymes [BR:vdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Vdis_1639
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Vdis_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1550677..1551885)
Genome map
AA seq 402 aa AA seqDB search
MKVTVSIIKADIGGLPGHAWVHPKILEFAADRLREEQKRGLIIDYFVYNVGDDMSLLMTH
TKGENNPDIHGLAWSIFKEATENIAKKVKLYGAGQDLLKDTFSGNIRGLGPQVAEMELEE
RPSEPLVVFAADKTEPGAFNLPFYRIFADPFNTAGLVIDPAMHQGFRFEILDVYEGKVYL
LDAPENSYDILGLIGTPGRYIIRRIYRKADLIQASVTSVERLNLIAGRYVGKDDPVAMVR
AQHGLPAVGEILEAFAYPHLVEGWMRGSHVGPLMPTKMISIDQEKKIALGPKMTRFDGPP
KVISLGFQLHDGYLEGPVDLFDDPAFDYSRQLAAQITDYIRRMGPVMPHRLPPEEMEYTT
LPQILSKLKPIPVDEYEKNRLQYIQFVTSQASGQATTGPSHD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcacggtctcgataataaaggcggacataggtggtttgcctggacatgcgtgg
gtacatcctaagatacttgagtttgcagccgataggcttagggaggagcagaagaggggg
ttgataattgattactttgtttataacgttggtgacgatatgtcattacttatgacccac
acgaagggtgagaacaaccctgatattcatggccttgcctggtcgatattcaaggaagcc
acggagaatatagccaagaaggttaaactctatggagctggtcaggacctactcaaggat
acctttagtgggaatattaggggcttaggtcctcaagttgccgagatggagcttgaggag
agacctagtgagccacttgtggtatttgctgcggataagactgagcctggagccttcaat
ttaccgttttatagaatattcgccgacccatttaacacggctggcctagtcatcgaccct
gcaatgcaccagggatttaggtttgagatcctggatgtctacgaaggtaaggtctaccta
cttgatgcgcctgagaatagttacgacatattaggtctaataggtacgccgggcaggtac
ataataaggaggatttataggaaggcagacctaattcaggcttccgtaacaagtgttgag
aggttgaacctaattgccggccgctatgttggtaaggacgacccagtggccatggttagg
gctcagcatggcttaccagcggttggtgagatactcgaggccttcgcctatcctcacctg
gttgagggctggatgaggggtagtcacgttggtccattaatgccgacaaagatgataagt
attgatcaggagaagaagatagcccttggtccaaagatgaccaggttcgatgggccaccg
aaggtcatatcccttggtttccagttgcatgatggttacctggagggtccagtggactta
tttgatgatccagcctttgactatagtaggcagttggctgcccaaataacggattacata
aggaggatgggcccagtaatgccgcatagattgccacctgaggagatggagtacacaaca
ttaccgcagatactctcgaaattaaagccaatacctgtcgatgagtatgagaagaataga
cttcaatacatacaattcgtgacatcacaggcaagtggtcaggcaaccacaggaccgagc
catgattag

DBGET integrated database retrieval system