KEGG   Vulcanisaeta distributa: Vdis_1656Help
Entry
Vdis_1656         CDS       T01313                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vdi  Vulcanisaeta distributa
Brite
Enzymes [BR:vdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Vdis_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Methyltransf_24 Methyltransf_25 Methyltransf_3 DUF938 CMAS Methyltransf_23 Methyltransf_11 Fibrillarin Methyltr_RsmB-F Met_10
Motif
Other DBs
NCBI-ProteinID: ADN51034
JGI: Vdis_1656
UniProt: E1QTW7
Position
1568128..1568775
Genome map
AA seq 215 aa AA seqDB search
MIDFASARRRLVNMLKDEGIIRSDRVERAMLSVPREEFLPSYLRLYAYEDTPLEIMYGQT
ISAPHMVAMMCELLDLRPGLRVLEVGTGTGYHAAVCAEAMERKGTVYTIEYYPGLALYAT
QNLAKLGYLGVVHVFIGDGSKGLPRYAPFDRILVTAAAPRVPPKLLEQLSSDGIMVIPIE
ERFTQVLYVVTKEDGVPHMRPVTYVSFVKMRYSEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgcatcggcaaggaggagattggttaatatgcttaaggatgaggggata
atcaggagtgatagggttgaaagggccatgctaagcgtaccccgtgaagaattcctacca
agctacctaaggctttacgcctatgaagatacaccactcgaaattatgtatggccaaaca
atctcagcgcctcacatggtcgccatgatgtgcgaattacttgatcttaggcctgggctt
agggtacttgaggttggcacgggcactggataccacgccgcagtgtgtgctgaagccatg
gagaggaagggcacagtgtatactattgagtattacccaggccttgccctctacgccact
caaaacctggctaaattgggttacttaggcgttgttcatgtgttcattggcgatggctca
aagggcctgcccaggtatgcgccgtttgataggatactcgttaccgcagccgcccccagg
gtgccgcccaagttacttgagcagttatcgagtgatggcataatggttataccaattgag
gagaggtttacccaggtactctacgtggttactaaggaggatggtgtaccccacatgagg
cccgtgacctacgtatccttcgtcaagatgaggtatagcgaggaataa

DBGET integrated database retrieval system