KEGG   Vulcanisaeta distributa: Vdis_1656Help
Entry
Vdis_1656         CDS       T01313                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vdi  Vulcanisaeta distributa
Brite
Enzymes [BR:vdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Vdis_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1568128..1568775
Genome map
AA seq 215 aa AA seqDB search
MIDFASARRRLVNMLKDEGIIRSDRVERAMLSVPREEFLPSYLRLYAYEDTPLEIMYGQT
ISAPHMVAMMCELLDLRPGLRVLEVGTGTGYHAAVCAEAMERKGTVYTIEYYPGLALYAT
QNLAKLGYLGVVHVFIGDGSKGLPRYAPFDRILVTAAAPRVPPKLLEQLSSDGIMVIPIE
ERFTQVLYVVTKEDGVPHMRPVTYVSFVKMRYSEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgcatcggcaaggaggagattggttaatatgcttaaggatgaggggata
atcaggagtgatagggttgaaagggccatgctaagcgtaccccgtgaagaattcctacca
agctacctaaggctttacgcctatgaagatacaccactcgaaattatgtatggccaaaca
atctcagcgcctcacatggtcgccatgatgtgcgaattacttgatcttaggcctgggctt
agggtacttgaggttggcacgggcactggataccacgccgcagtgtgtgctgaagccatg
gagaggaagggcacagtgtatactattgagtattacccaggccttgccctctacgccact
caaaacctggctaaattgggttacttaggcgttgttcatgtgttcattggcgatggctca
aagggcctgcccaggtatgcgccgtttgataggatactcgttaccgcagccgcccccagg
gtgccgcccaagttacttgagcagttatcgagtgatggcataatggttataccaattgag
gagaggtttacccaggtactctacgtggttactaaggaggatggtgtaccccacatgagg
cccgtgacctacgtatccttcgtcaagatgaggtatagcgaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system