KEGG   Vulcanisaeta distributa: Vdis_1904Help
Entry
Vdis_1904         CDS       T01313                                 

Definition
magnesium chelatase ChlI subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Vdis_1904
Enzymes [BR:vdi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Vdis_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1793713..1795656)
Genome map
AA seq 647 aa AA seqDB search
MSRRVTFPFPAIVGLDKAKSALLAVAVNPLIGGVLLRGDKGTGKTTLVRSFADVLPEVEV
VADCPFNCDPRDPQLMCDSCYARYQRGERLPVAIKKMRVIDLPLSITVDRLVGTLDIKRA
ITEGVRALQPGLLAEANRNILYIDEVNLLDDYIIDILLDAAAYGWNVVEREGVSVKHPAR
FILVASMNPEEGELRPQLLDRFGLIVDVEAPRDPEVRAEIVRRVEEFNRDPEGFYRRWEP
EIKKIREEIRKARELVKRVEMPDDLLKTLVETIIKLDIRTSRAEIVTTRTAKALAALEGR
TRVTMEDLQRAMELALPHRLKARPFERPKPPILPQPLINDNNTRNEQPGQTPNQRGGMLR
DGMSTAQDEHSNAGTGGNVGGVDGNSRRYGVASVGIPVEFRKEFIHAGSHGLGSRSSFRR
IVGQPHGIPYMYLPISNKEGSADVDLTASIVHAALRGAGLPIKVDWGDLMVRVRRVRAPR
ISLIVLDASGSMNFMRRIEVAKGLVRRIAEESYVKRSYVGLISFRGRGVDVIIEPTRNYW
QVLSTLEGLPSGGATPLSAALACAVDLIKRLGLKLRGDYWVYVITDGKANVPLMKDVREE
LESFMVELSRLAKVVIYDTRPQLIYDPSITYIDVLSKYAVDTVRVGD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcgtgttacctttccgttccccgccatcgtggggttggataaggctaagtcg
gcccttctcgccgtcgctgttaacccattaattggcggtgtcctgcttaggggtgataag
ggtactgggaagaccacgctagttaggtcctttgcggatgtgctgcctgaggttgaggtg
gtggccgactgcccattcaattgcgacccacgcgatccgcaactgatgtgtgactcatgc
tatgccaggtaccagaggggtgagaggttgccggtggcgattaaaaagatgagggttatt
gacctacccctctcaataaccgtcgataggcttgtcggcacgctggacatcaagagggca
ataacggagggcgtgagggcactccaacctggccttttagctgaggctaacaggaacatc
ctatacattgatgaggttaacctactcgatgattacataatcgacatactcctggacgca
gccgcctacggctggaacgtggtggagagggagggcgtgtccgtcaaacacccggccagg
ttcatactagtggcctccatgaatcccgaggaaggtgaactcaggcctcaacttctcgat
aggtttggcctcatcgtagatgtagaggctcccagggacccggaggtgagggctgagatt
gttaggagggttgaggaattcaatagggaccccgagggcttttacagaaggtgggaacct
gagattaagaagattagggaagagattaggaaggccagggaattggtgaaaagggttgag
atgcctgatgacctactcaagaccctagttgagactataattaaactggacataaggacg
agtcgcgccgagatagtcacgacaaggaccgctaaagcattagcggcgttggaggggagg
actagggtcaccatggaggatttacagagggccatggaacttgcactaccacataggctc
aaggcccggccattcgagaggcctaaaccaccgatactccctcaaccattgattaacgat
aataacacacggaatgaacaaccagggcaaacacctaaccagcgaggtggcatgttgagg
gatggcatgagcacggcacaagatgaacatagcaatgcaggtactggaggtaatgtaggc
ggtgtggacggtaattccaggaggtatggggtagctagcgtgggtattccagtggagttt
aggaaggagttcatacacgctggaagccatgggctggggtcaaggtcctccttcaggagg
attgttggtcagccccacggtattccatacatgtacctaccaattagtaataaggagggc
tcggctgatgttgatttaacggcatcgatcgtgcacgcagcgcttaggggtgcggggttg
ccgattaaggttgattggggagacctaatggttagggttaggagggttagggccccgagg
atctcgctgatagtccttgacgccagcggtagtatgaacttcatgagaaggattgaggta
gcaaagggactggtgaggagaatagccgaggagtcttacgtgaagaggagttacgtaggt
ctcataagtttcagaggccgtggcgtggacgtgattatcgaaccaacgaggaattactgg
caggtattaagtactctagaggggttaccaagcggtggcgcgacgccgttatctgcggca
ctcgcctgcgccgttgacctaattaagaggttgggccttaagttgaggggtgattactgg
gtctacgtcataactgacggtaaggccaacgtacctttaatgaaggatgtcagggaggag
ctcgagagcttcatggtcgagttaagtaggttggctaaggtggttatttacgatacaagg
ccgcagttgatttatgacccatcgataacgtacattgacgtactcagtaagtacgcggtg
gatactgtcagggttggtgactaa

DBGET integrated database retrieval system