KEGG   Vulcanisaeta distributa: Vdis_1933Help
Entry
Vdis_1933         CDS       T01313                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vdi  Vulcanisaeta distributa
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vdi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1823067..1823972)
Genome map
AA seq 301 aa AA seqDB search
MSNNIDFYVVPQYTLFGVPKCGRGIPILGIPMEDTVSFRPGTRFAPSVIRTWSQYFEFTP
TEDLGIDPLEKACDLGDLSLMQGMADKNLERINLVVKDAINTWGRVVNIGGEHTLSLGVA
RAVRESQGSYGIYIHVDAHLDSREEWPLGQSLSHATFVRHIINQVRPQSLVFLGFRSYDK
EEINFVRGLENSTLLSTRDIRSMDYHELRLLIRGVIDSYPGPIHLSIDVDVLDPSIMPGV
GNPEGFGLNYGELLRIIKAVLDYGGSRVKAVDLVEYSPPNDPGLMSLPTIIKLILDVLNY
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataatatcgacttctacgtcgtcccccaatacacattattcggagtgcccaag
tgtggccgtggtataccaatacttggtatacccatggaagatacggtcagttttagaccg
ggaacacgattcgcgcccagtgttattaggacctggagccagtacttcgaatttacacct
accgaggatctgggcattgacccacttgagaaggcctgcgatttgggggatttatcgtta
atgcagggcatggccgacaagaatctagagaggatcaacttagtggttaaggatgccatt
aatacatggggtagggtagtcaatataggtggtgaacacacgctaagccttggtgttgcc
agggctgttagggagtcacagggttcatacggcatttacatacatgtagatgcgcacttg
gattcaagggaggagtggccgctggggcagtctttatcacatgccacattcgtaaggcac
ataattaatcaggttaggcctcagtcacttgttttccttgggtttaggtcatacgataag
gaggaaattaattttgtgaggggtctcgagaattccacgttattatcaactagggatata
aggtccatggattaccacgagcttaggcttctcattagaggtgtgattgatagttaccct
gggccaatacacctcagcattgatgttgatgttcttgatccctcgataatgcctggtgtc
ggtaacccggagggtttcgggcttaactacggcgagctactgaggattattaaggctgtt
ctcgactatggcggttccagagttaaggcggtggatctcgttgagtactcaccgcccaat
gacccagggttaatgtcgttgccaacgattatcaagttaatattggacgtacttaattac
ctgtga

DBGET integrated database retrieval system