KEGG   Vulcanisaeta distributa: Vdis_1936Help
Entry
Vdis_1936         CDS       T01313                                 

Definition
(RefSeq) pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vdis_1936
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1936
   00020 Citrate cycle (TCA cycle)
    Vdis_1936
   00620 Pyruvate metabolism
    Vdis_1936
   00640 Propanoate metabolism
    Vdis_1936
   00650 Butanoate metabolism
    Vdis_1936
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_1936
   00680 Methane metabolism
    Vdis_1936
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Vdis_1936
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Vdis_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1825291..1825608
Genome map
AA seq 105 aa AA seqDB search
MKQLTWKDLPIGGVVTEPGNARKNLTGTWRTERPVIDQDACIRCRICWMYCPEPAILELK
KPYVTKTGKKYDLTYEIDYDHCKGCGICAHECPVKAIKMVPEVAG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaacctggaaggatttaccaatcggtggcgtagttactgagccaggtaat
gcgcgtaagaacctaaccggtacttggaggactgagagacccgttattgatcaagatgcg
tgcattaggtgtaggatttgctggatgtattgccctgaaccggcaatacttgagttgaag
aagccttatgtcacgaagacgggcaagaagtatgacttaacttatgagattgattacgac
cactgcaagggctgtgggatatgtgcccatgaatgcccagtcaaggcaataaagatggtg
ccagaggtggctgggtaa

DBGET integrated database retrieval system