KEGG   Vulcanisaeta distributa: Vdis_1976Help
Entry
Vdis_1976         CDS       T01313                                 

Definition
(GenBank) Cellulase
Organism
vdi  Vulcanisaeta distributa
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1860139..1861191)
Genome map
AA seq 350 aa AA seqDB search
MDIDLLSRLSTEVGPSGFEDRVRRVIRGLVSDYADDVRVDNMGNLIARVGDGSFKVLISA
HMDEVGVMVSHIDQRGFLRIVPIGGLDPWTLLDKELIFMGKDGDVVGVVGVDPPHLRKEK
PPSKFEELYVDAGFSSRDEALKNGIMPGTPGTFAGSFRQRGSVVIGKAFDNRVGCTVLID
ALKSIRNKVGGDVSLYFAWNTQEEVGLRGINAVVHQVNPNVAFIVETTVAADVPTSSEDV
WVTRLGGGAALRAFDRSMITNPRLLSVAIEVAESSNIKYQVQVNPYGGTDAGVIHMYGTG
VPSLVISTPARYIHSPASLINTDDLKQVEDLLKTLLLNIDVIRSKALISE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggacatagacttacttagtcgattatcaacggaggtgggtccctcaggattcgaggat
agggtaaggagggttatcaggggcttagtgagtgactatgccgatgatgttagggttgat
aatatgggtaacctcattgcgagggttggtgatgggtcatttaaagtcttaattagtgct
catatggatgaggtaggcgtaatggtttcacacatagatcaaagaggcttcctaagaata
gtacccattggtggtttagatccctggacactactcgataaggagttaatattcatgggt
aaggatggtgacgtggttggtgtcgtgggcgttgacccgccacacttacgtaaggagaag
ccaccctcaaagtttgaggagttatatgtcgatgctggctttagcagtagggatgaggcc
ttaaagaatggaattatgccagggaccccaggtacatttgcaggtagttttaggcagagg
ggttctgtggttattgggaaggcatttgataatagggttggttgtaccgttctgattgac
gcacttaagagcattagaaataaggtgggtggtgacgtatcattatacttcgcgtggaat
acacaggaggaggttggccttaggggtatcaatgccgttgttcaccaggttaatcctaat
gtggcttttatcgtggagaccacggtagccgccgatgtaccaacgagtagtgaggatgta
tgggttacaaggctcggtggtggtgccgcactgagggcatttgataggtctatgattaca
aacccaaggttgttgtccgtggccattgaggtggctgagagcagcaatattaagtatcaa
gtccaggttaacccatatggaggtacagacgcgggtgtgatacatatgtatggtacaggt
gttccatcattagtaatctctactccagcaaggtacatacattcaccggcatcattaata
aacactgatgacctaaagcaggttgaggatttacttaagaccctattgctaaatattgat
gtgattaggagcaaggccttgattagtgagtaa

DBGET integrated database retrieval system