KEGG   Vulcanisaeta distributa: Vdis_1987Help
Entry
Vdis_1987         CDS       T01313                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00010  Glycolysis / Gluconeogenesis
vdi00020  Citrate cycle (TCA cycle)
vdi00620  Pyruvate metabolism
vdi00633  Nitrotoluene degradation
vdi00640  Propanoate metabolism
vdi00650  Butanoate metabolism
vdi00680  Methane metabolism
vdi00720  Carbon fixation pathways in prokaryotes
vdi01100  Metabolic pathways
vdi01120  Microbial metabolism in diverse environments
vdi01130  Biosynthesis of antibiotics
vdi01200  Carbon metabolism
Module
vdi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_1987
   00020 Citrate cycle (TCA cycle)
    Vdis_1987
   00620 Pyruvate metabolism
    Vdis_1987
   00640 Propanoate metabolism
    Vdis_1987
   00650 Butanoate metabolism
    Vdis_1987
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_1987
   00680 Methane metabolism
    Vdis_1987
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Vdis_1987
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Vdis_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N T2SS-T3SS_pil_N
Motif
Other DBs
NCBI-ProteinID: ADN51359
JGI: Vdis_1987
UniProt: E1QNZ4
Position
complement(1871313..1872527)
Genome map
AA seq 404 aa AA seqDB search
MSRQISLAKQVRKVLVGDHAVAEAVKLARVNVISAYPITPQTLIVERISEMIERGELRAD
YVRVESEFAALATVYGAAAGGARAFTATSSHGLFYMYEMLWWAAASRVPLVMAVVTRVVG
PPWNIHDEHTDLLAIRDSGWIIGMAQNVQEAFDMTLTAFRISEDERVLLPVAVGLDGFIL
SHTAEPLDIPSQEDVDAWLPPRNPRIPYVIEPGGETITMGNLPRNDVYHALLKKYMDESM
ESAKKVIADVYDEYGKLTGRKYGPLTECYRCSDAKYLAVSMGAWSGDIMTAVDRLRDEGY
PIGLLRIRYIRPFPEEDITGWINGMKGVIVFDRDYSAGMGGILASEVSGFVPSNVSFEGI
LAGVGGFDVSPDEFKTLMMEFINKVEHEGLVRVRKYWYIPKIER
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggcagatatccctcgccaaacaggttaggaaggtattggtcggcgatcacgcg
gttgctgaggccgtgaaactagctagagttaacgtgatatcggcatatccaataacaccg
cagacattaattgttgagagaattagcgagatgattgagagaggagagttgagggctgat
tacgtgagggtcgagagcgaatttgccgcattagctacggtatatggagcggctgcgggc
ggcgcgagggcttttactgcaacttcaagccacggcctattctacatgtacgaaatgctc
tggtgggccgcagcctcaagggttccactcgtaatggccgtggttactagggttgttggc
ccgccgtggaatatacatgatgagcacacggatttactagccattagggatagtggttgg
ataattggtatggctcagaacgtgcaggaggcctttgatatgacattgacagcatttaga
ataagtgaggatgaaagagtgctattaccagtcgctgttgggcttgatggattcatactt
agccatactgcggagcccctcgatatcccatcacaggaggacgtagatgcttggttacca
cctaggaacccgagaatcccgtacgtcattgagcctggcggtgagaccataacaatgggt
aatctaccccgtaatgacgtttaccatgcattgctcaagaagtacatggatgagtccatg
gagtccgcaaagaaggttattgcggatgtctatgatgaatatggtaaattaaccggtagg
aagtatgggccattgactgaatgttatagatgcagtgatgctaagtatttggcagtgtca
atgggtgcgtggagtggggatataatgactgcggttgataggcttagggatgagggatat
cccattggcttattaagaattaggtatatcaggccattccctgaggaagacattactggg
tggattaatggcatgaagggtgtaatagtgtttgacagggactactcagcgggtatgggt
ggaattcttgcaagtgaggtaagtggttttgtgcctagtaacgtatcgtttgaaggcata
ttagcgggggttggtggtttcgacgtctcacctgatgagtttaagacgttaatgatggag
ttcattaataaggtagaacacgaaggcctggtgagggttaggaagtattggtatataccg
aagattgagaggtga

DBGET integrated database retrieval system