KEGG   Vulcanisaeta distributa: Vdis_2090Help
Entry
Vdis_2090         CDS       T01313                                 

Definition
dissimilatory adenylylsulfate reductase subunit beta (EC:1.8.99.2)
Orthology
K00395  
adenylylsulfate reductase, subunit B [EC:1.8.99.2]
Organism
vdi  Vulcanisaeta distributa
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Vdis_2090
Enzymes [BR:vdi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With other acceptors
    1.8.99.2  adenylyl-sulfate reductase
     Vdis_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1965436..1965924)
Genome map
AA seq 162 aa AA seqDB search
MPSYVIPAKCTGCGDCVNICPSHIMRFTKSGIFGRKAYNAEPESCWECYNCVKHCPQGAV
QIRGYMDFTPLGGAVEVYRDEKTNRVYWTIRYRNGTVKYFVFPIRTTPWGSIKPPQEYPE
PPREFLRTPYLSCEHEKLGGNKLGVELPRTKVPEVVKAEVRG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctatgtaatcccggccaagtgcacgggatgcggggactgcgttaacatatgc
ccaagtcacataatgaggttcacgaagtccggcatattcggtaggaaggcatacaacgcg
gagccggagtcctgctgggagtgctacaactgcgttaagcactgcccacagggcgctgtc
cagataaggggctacatggacttcacaccacttggtggtgccgttgaggtttacagggat
gagaagactaacagggtttactggacaattaggtataggaatggcacggttaagtacttc
gtatttccaataaggaccacgccctggggttcaataaagccaccgcaggaatacccggag
ccacctagggaattcctgaggacgccgtacctatcctgcgagcatgagaagcttggcggt
aataagctcggcgttgaactacccagaacgaaggttccagaggttgttaaggctgaggtg
agggggtga

DBGET integrated database retrieval system