KEGG   Vulcanisaeta distributa: Vdis_2196Help
Entry
Vdis_2196         CDS       T01313                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00010  Glycolysis / Gluconeogenesis
vdi00052  Galactose metabolism
vdi00500  Starch and sucrose metabolism
vdi00520  Amino sugar and nucleotide sugar metabolism
vdi00521  Streptomycin biosynthesis
vdi01100  Metabolic pathways
vdi01110  Biosynthesis of secondary metabolites
vdi01120  Microbial metabolism in diverse environments
vdi01130  Biosynthesis of antibiotics
vdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vdis_2196
   00052 Galactose metabolism
    Vdis_2196
   00500 Starch and sucrose metabolism
    Vdis_2196
   00520 Amino sugar and nucleotide sugar metabolism
    Vdis_2196
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Vdis_2196
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Vdis_2196
Enzymes [BR:vdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Vdis_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADN51564
JGI: Vdis_2196
UniProt: E1QQ77
Position
complement(2050388..2051380)
Genome map
AA seq 330 aa AA seqDB search
MVYVGVDVGATYIRVGLVSEDGQVINKVKTRQPMSGDENTVANVIIKSIRDLTGGGGIDG
IGIGSIGPLDLREGIVPWAPNAPIKRFKLVEPIIREFRVPVVLGNDAMAAVWGEYLFGIG
KGVNNLVYITLSTGIGAGVIVDGHLLIGKDGNAHEIGHMVIDVNSEIQCGCGGYGHWEAL
GSGANIPRVIKEFVRGRSYKSRLYERLTKDEYVSTEEVFRAYYEGDELARDFIDNYLMRV
HAAGLASVMNAYDPELIVLGGSMALNNMDLFRRGIEKYLKRYLAVKPARIEFTRFGDDIG
ILGAAALAIKVPESLRTYVEQYRKFLKLSY
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgttggtgttgatgttggcgcaacgtacataagggttggacttgtgagtgag
gatggtcaagttatcaataaggtgaagacgagacaaccaatgagtggtgacgagaatacc
gtagccaacgtaattattaagtcaataagggatttaacgggtgggggtggcattgatggt
ataggtattggctccataggtccgttagacctgagggagggtatcgtaccctgggcaccg
aatgcaccaatcaagaggtttaagcttgtggaaccaataatcagggagttcagggtaccc
gtggtcctgggtaacgatgctatggcagctgtgtggggcgagtacctattcggtattggt
aagggcgttaataacctcgtctacataacccttagcaccggcattggtgctggcgtcata
gttgacggacacctactcattggcaaggatgggaatgctcacgaaattggccacatggtc
attgacgtgaattccgaaatacagtgtggctgtggtggttatgggcattgggaggccctc
ggttcaggggctaatataccgagggtcattaaggaatttgttagggggaggtcgtataag
tcaaggttgtatgagagacttaccaaagacgagtatgtgagtactgaggaggtatttcgg
gcttattatgagggggatgagctcgccagggatttcatagataattacctaatgagggtg
cacgcggctggcttagccagcgtcatgaatgcttacgatccagaattaatagtgctgggg
ggttcaatggcccttaataacatggatttatttagaaggggaattgaaaaatacctaaag
agatacttagctgttaaaccagcgcgaatagagtttactaggtttggtgatgacataggc
atactgggtgcggcggcattggcaataaaagtgcctgagtcattaaggacctatgtcgag
cagtataggaagttccttaagctaagttattaa

DBGET integrated database retrieval system