KEGG   Vulcanisaeta distributa: Vdis_2212Help
Entry
Vdis_2212         CDS       T01313                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vdis_2212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_2212
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vdis_2212
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vdis_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2064016..2065317
Genome map
AA seq 433 aa AA seqDB search
MGLEKYRIDLPIDEIPTYWYNILADLPEPLPPPYDPDNGKRLELLKQVIPSEPLRLEFST
ERFVKIPEEVLERYLQVGRPTPLIRAKRFEEYLNAPVRIYLKMEGYTYTGSHKINSALAW
VYYALKDGAKFVTTETGAGQWGSAVALAAALFKVKAHIFMVRASYYAKPLRRYLMQMYGA
EVHPSPSELTEFGRKLLRENPNHPGSLGIAITESAEYALKNGGKYVVGSVINADIMFKTI
AGLEAKKQLELIGEDPDVMIGVVGGGSNWGGAFYPFIGEELRSGKVRRRYIAVGALEVPK
VTRGVYKYDDPDTGRVLPQLKMYTIGADFVPPPIYAGGLRYHAVAPTLSYLMYKGYVEGR
DYDQETVFKMAQIFAQVEGYVPAPETAHVLPVVKEIADEARRTGEKRVILISFSGHGLLD
LGNYADVLGFEKA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ctgggactggaaaagtatagaatagatctccccatagatgaaataccaacatattggtac
aacatactcgcagacttgccagaaccactgccgccaccgtatgatcctgataatggtaaa
aggcttgagcttcttaagcaggtaataccatcagagccgctgaggcttgagttctccaca
gagagattcgtgaaaatacctgaagaggtcctggaacgttacctacaagtgggtagacca
acgcctttaatcagggcgaagaggtttgaggaatacctcaacgcgccggtcaggatatat
ttaaagatggagggatatacctacacgggtagccataagataaactcagcacttgcctgg
gtatattatgcgctcaaggatggtgctaagttcgtgactacagagacgggtgctgggcag
tggggttcggcggtggcgttagccgcggcattatttaaggttaaggcccacatattcatg
gttagggctagttattatgcaaagccattgaggaggtacttaatgcagatgtatggtgct
gaggtccatccaagtccaagcgaattaacggagttcggtaggaagttactacgtgaaaac
ccaaaccacccaggtagcctgggcattgcaataacggagtccgccgaatatgcattgaag
aatggcggtaagtacgtggtgggtagtgtaataaatgctgacataatgtttaagacaatt
gcgggccttgaggctaagaagcaactggaattgattggcgaggatcccgacgtaatgatc
ggtgtggttggcggtggatctaattggggtggtgcgttctatccctttattggtgaagag
ctcaggagtggtaaggttaggcgtaggtacattgccgttggggcccttgaagttccaaag
gtgactaggggcgtctataagtatgatgatcctgacacaggtagggtgctgcctcaattg
aagatgtacaccataggcgccgatttcgtaccaccacccatctacgctggcggtctccgt
taccatgccgtggcgccaacactgtcgtacctgatgtataagggttatgttgagggtcgt
gattatgaccaggaaaccgtatttaagatggcccagatatttgcccaggttgaggggtat
gtgcctgcgccggagacggctcatgtgctgcctgttgttaaggagattgctgatgaggct
aggaggactggtgagaagagggtcattttaattagtttctcaggacatggattacttgac
ctgggcaattacgcagatgtacttggcttcgagaaggcgtga

DBGET integrated database retrieval system