KEGG   Vulcanisaeta distributa: Vdis_2212Help
Entry
Vdis_2212         CDS       T01313                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vdi  Vulcanisaeta distributa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vdis_2212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vdis_2212
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vdis_2212
Enzymes [BR:vdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vdis_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2064016..2065317
Genome map
AA seq 433 aa AA seqDB search
MGLEKYRIDLPIDEIPTYWYNILADLPEPLPPPYDPDNGKRLELLKQVIPSEPLRLEFST
ERFVKIPEEVLERYLQVGRPTPLIRAKRFEEYLNAPVRIYLKMEGYTYTGSHKINSALAW
VYYALKDGAKFVTTETGAGQWGSAVALAAALFKVKAHIFMVRASYYAKPLRRYLMQMYGA
EVHPSPSELTEFGRKLLRENPNHPGSLGIAITESAEYALKNGGKYVVGSVINADIMFKTI
AGLEAKKQLELIGEDPDVMIGVVGGGSNWGGAFYPFIGEELRSGKVRRRYIAVGALEVPK
VTRGVYKYDDPDTGRVLPQLKMYTIGADFVPPPIYAGGLRYHAVAPTLSYLMYKGYVEGR
DYDQETVFKMAQIFAQVEGYVPAPETAHVLPVVKEIADEARRTGEKRVILISFSGHGLLD
LGNYADVLGFEKA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ctgggactggaaaagtatagaatagatctccccatagatgaaataccaacatattggtac
aacatactcgcagacttgccagaaccactgccgccaccgtatgatcctgataatggtaaa
aggcttgagcttcttaagcaggtaataccatcagagccgctgaggcttgagttctccaca
gagagattcgtgaaaatacctgaagaggtcctggaacgttacctacaagtgggtagacca
acgcctttaatcagggcgaagaggtttgaggaatacctcaacgcgccggtcaggatatat
ttaaagatggagggatatacctacacgggtagccataagataaactcagcacttgcctgg
gtatattatgcgctcaaggatggtgctaagttcgtgactacagagacgggtgctgggcag
tggggttcggcggtggcgttagccgcggcattatttaaggttaaggcccacatattcatg
gttagggctagttattatgcaaagccattgaggaggtacttaatgcagatgtatggtgct
gaggtccatccaagtccaagcgaattaacggagttcggtaggaagttactacgtgaaaac
ccaaaccacccaggtagcctgggcattgcaataacggagtccgccgaatatgcattgaag
aatggcggtaagtacgtggtgggtagtgtaataaatgctgacataatgtttaagacaatt
gcgggccttgaggctaagaagcaactggaattgattggcgaggatcccgacgtaatgatc
ggtgtggttggcggtggatctaattggggtggtgcgttctatccctttattggtgaagag
ctcaggagtggtaaggttaggcgtaggtacattgccgttggggcccttgaagttccaaag
gtgactaggggcgtctataagtatgatgatcctgacacaggtagggtgctgcctcaattg
aagatgtacaccataggcgccgatttcgtaccaccacccatctacgctggcggtctccgt
taccatgccgtggcgccaacactgtcgtacctgatgtataagggttatgttgagggtcgt
gattatgaccaggaaaccgtatttaagatggcccagatatttgcccaggttgaggggtat
gtgcctgcgccggagacggctcatgtgctgcctgttgttaaggagattgctgatgaggct
aggaggactggtgagaagagggtcattttaattagtttctcaggacatggattacttgac
ctgggcaattacgcagatgtacttggcttcgagaaggcgtga

DBGET integrated database retrieval system