KEGG   Vulcanisaeta distributa: Vdis_2468Help
Entry
Vdis_2468         CDS       T01313                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
vdi  Vulcanisaeta distributa
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2305841..2307364
Genome map
AA seq 507 aa AA seqDB search
MSNANILLDRLKPTRTISGVVPIAIMVEPVACPFNCTYCPGGRKTNTPKSYLPDSPVVLR
AAPLNYDPYKQVVARIRQYEALHHPVSKVELIVMGGTVTSLPESYLMWFVGNAFKAINDY
PLVNSGPVDNPDIEYEHRRNEKARIRVVALELETRPDFARPRHIDLMLRLGFTRVEIGVQ
SIYDDILRRVKRGHGVKEVTEATQYLKDAAYKVCYHIMPGLPGSTPDRDLEMVKTIFDDP
SFMPDCVKVYPTFVVKDTELYEEWLRGLYRSYDEETWHWLLANIMASIPRWVRVMRFGRD
IPLHWVVDGPRIGNMREVVLRDMEKLGLKCMEIRCREVGHKYVKRGLVPTPRRLMINRID
YDASGGHEVFLEVIDEDDTLYGILRLRIPSSNAHRPEIRIGRAALIRELHVYGPELPIGS
RATDLFWWQHRGIGRALMARAEHIALEEFNAYRMFVISGVGVREYYRRLGYRKYPSSFYM
FKDLRKSILTENEVNEVFLENENLIMD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgctaatatattgctagataggttaaagcctaccaggacgatatccggggta
gtcccgattgcgataatggtagagcccgtggcatgcccattcaactgcacgtattgtcca
ggcgggaggaagacaaacacgccaaagagctacctcccggactcacccgtggtcctcagg
gccgccccactgaattatgacccatataagcaggtcgtggctagaataaggcagtacgaa
gccctgcaccacccagtatccaaggttgagttaatagtaatgggtggtacagtgacgtca
ttacccgagtcatatttaatgtggttcgttggtaatgcattcaaggccattaatgattac
cccctcgtaaattcgggacccgtggataacccagacattgagtatgagcataggcgtaat
gagaaggctaggatcagggtcgtagcccttgaactcgagacaaggcctgacttcgcaagg
ccgagacatatagacctaatgcttaggcttgggtttacgagggttgagatcggtgttcaa
tcaatatatgacgatatcctaaggagggttaagcggggtcacggcgttaaggaggtcacc
gaggcgacacaatacctaaaggacgcagcgtataaggtttgttaccacataatgcctggg
ctccctggctcaacaccagatagggatctcgagatggttaagacaatattcgatgaccca
agcttcatgcctgactgcgttaaggtttacccaaccttcgttgttaaggacacggaatta
tatgaggaatggttaaggggtctatacagaagttatgatgaggagacctggcattggtta
ttggctaatatcatggcgtcaatccccaggtgggtcagggttatgaggtttggcagggac
ataccacttcactgggttgttgacggcccaaggataggtaacatgagggaggtggtgctt
agggacatggagaaactaggccttaagtgcatggagattaggtgccgtgaggttggccat
aagtacgtaaagaggggtcttgtaccaacgccgaggaggttaatgattaataggattgat
tacgatgcctcaggtggccacgaggttttcctggaggtcatcgacgaggatgacaccctc
tacggaatactaaggctcagaataccaagtagtaatgcgcataggcctgagattaggatt
ggtagggcagccctaattagggagttgcatgtttatggtcccgaactaccaattggtagt
agggcaactgacttattctggtggcaacaccgtggtattggtagagcgttgatggcgagg
gctgagcacatagcccttgaggagtttaatgcttataggatgttcgtgatatcaggcgtt
ggcgttagggagtactataggaggcttggttataggaagtaccccagcagtttctacatg
tttaaggaccttaggaaatcaatattgaccgagaacgaagtaaacgaggtattcctagag
aatgagaacttaataatggattag

DBGET integrated database retrieval system