KEGG   Vulcanisaeta distributa: Vdis_2480Help
Entry
Vdis_2480         CDS       T01313                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vdi  Vulcanisaeta distributa
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vdi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2317461..2318357
Genome map
AA seq 298 aa AA seqDB search
MRFVRESMYKFIKDPGDIRIGEVIKRGWVSGDVGILGVPWDGAVGTRPGSRLAPARVRSW
LYSSPYIFSNVSIVDLGDVDVVVGDHNETWRRVEETVSEALGLVRELIVIGGDSTSSYAA
FRGLRKAVNDGLAYVLLDAHPDVRVITEGLTSGQVVRWIRSVDPNAYIAIIGVRTYSNAP
YLFDEARKLGITVYTIDQVDSMGINAVVSEIVSNTNNRVVHLSINLDVVDPAFAPGVNSP
SPGGFTSREVIRLVRELSIRLRPRVFDIVEVTPPFDVNDVTSMLASAIIVNAIWISKT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttgttagggagtccatgtataagtttatcaaggaccctggtgatatcaggatc
ggcgaggttatcaagagaggttgggttagtggtgatgttggtattctcggtgttccctgg
gatggggcggtaggtacgagacctggctctaggcttgcccctgccagggttaggtcctgg
ctttactcctcaccctacatcttcagcaatgtttcgattgttgatctcggcgatgttgat
gtggttgttggtgatcataatgagacttggcgtagggttgaggagacggtcagtgaggcg
ttggggcttgttagggagttgatcgtcattggtggcgacagtacatcctcctacgcagcg
tttagaggcttgaggaaggcagttaatgatgggttggcgtatgtcctacttgatgctcac
cccgatgttagggtcattaccgagggtctgacgagcgggcaggtcgttaggtggattagg
agtgttgacccaaacgcctatatagccataatcggcgttaggacttattcaaacgcacca
tacctatttgatgaggctaggaagttaggtattacggtatacacgattgatcaggtggac
tccatgggcattaatgctgtggtcagcgagattgtgagtaatactaacaatagggttgtt
cacctgagcattaatcttgatgttgtcgacccagcattcgcacccggcgtcaatagccca
tcacctggtggcttcacgtcaagggaggtaattagacttgttcgcgaattaagcattagg
ttaaggcccagggtttttgatattgttgaagtcacaccgccctttgatgttaatgatgtg
acgagtatgctcgcctctgcgataatagtcaatgccatatggattagtaagacgtga

DBGET integrated database retrieval system