KEGG   Vulcanisaeta distributa: Vdis_2498Help
Entry
Vdis_2498         CDS       T01313                                 

Definition
(RefSeq) NAD-dependent epimerase/dehydratase
  KO
K08678  
UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
vdi  Vulcanisaeta distributa
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Vdis_2498
   00520 Amino sugar and nucleotide sugar metabolism
    Vdis_2498
Enzymes [BR:vdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Vdis_2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2335656..2336537)
Genome map
AA seq 293 aa AA seqDB search
MKILVTGSSGFLGRNIVNCMRSKGHDARGLDIVKAETTDYIIDITRRDDVIGLSKEGFDA
IVHLAAYPNPRSFTNAGALKGLDVNVVGTINMLELARILNARFLLYSTSNVYGKPTKLPV
TEDDPLRPFEGYGWSKVAAEAVSMSYHVVHKVPVTIFRLWKPYGPHDNGVVGIFITRALK
NEDLVVNNGGVDTTDFLYVEDLCDATELALRKDDAVGQAFNIGLGVETSILDLARIIVKL
VGSNSKINVQPRTSEPFRSYPDVSKAMRILGFKPKYDLVSGLRATIDWFRRNL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattagtgacaggttcctcaggattcctagggaggaacatagttaattgcatg
aggtctaagggccatgacgcgaggggtctcgatattgttaaggcggagactacggactac
ataatcgatataacaaggcgagatgatgttattgggctttctaaagaggggtttgacgca
attgtccacttggcagcatacccgaacccaaggtcattcacgaacgcgggcgcccttaag
ggccttgatgtaaatgttgttggtacaataaacatgcttgagctcgcaaggatactaaat
gccaggttcctactttactcaacatctaacgtttacggtaagcccactaaattgcccgtc
actgaggatgacccattaaggcccttcgaggggtatggttggagtaaggtcgctgccgag
gccgtatcgatgtcctatcacgttgttcataaggttccagtaacgatatttaggctgtgg
aagccctatggccctcatgataatggcgttgtcggaatattcataacgagggcattaaaa
aatgaggacctggtagttaataatggtggtgttgataccacggatttcctctatgttgag
gatttatgtgatgccacggaactagcacttaggaaggatgatgcggtcggtcaagccttc
aatatcgggctcggcgttgagacatcaatactagatttagccagaataatagttaagcta
gttggttcgaattccaaaattaatgtgcaaccaaggacctccgagccatttaggagttac
ccagacgttagcaaggccatgaggatcctcggctttaaacctaaatatgacttagtaagt
ggattaagagccaccattgattggtttaggcgaaatctatga

DBGET integrated database retrieval system