KEGG   Verminephrobacter eiseniae: Veis_0036Help
Entry
Veis_0036         CDS       T00460                                 

Definition
phosphoglycerate mutase 1 family protein (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Veis_0036
   01230 Biosynthesis of amino acids
    Veis_0036
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_0036
  Energy metabolism
   00680 Methane metabolism
    Veis_0036
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Veis_0036
Enzymes [BR:vei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Veis_0036
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Veis_0036
  Exosomal proteins of melanoma cells
   Veis_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(48218..48955)
Genome map
AA seq 245 aa AA seqDB search
MHQLVLIRHGESTWNLENRFTGWTDVPLTPTGVSQALSAGRLLKAEGYMFDLACTSVLQR
AIHTLWHVLDEMDCSWLPVVGDWRLNERHYGALQGLNKADMARQYGADQVLLWRRSYDTP
PPALAVSDPRCERNDRRYAGVPAVPLTECLKDTVARVLPFWTQVIAPAIVSGKRVVLVAH
GNSIRALVKYLDRIAEADIVGLNIPNAIPLVYELDANLSPIRHYYLGDADAAAQAAAAVA
AQGQA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaactcgtcctgatccgccacggcgaatccacctggaacctcgaaaaccgcttc
accggctggaccgatgtccccctgacgcccaccggcgtgtcccaggccctgtcggcgggg
cggctgctcaaggccgagggctacatgttcgatctggcgtgcaccagtgtgttgcagcgc
gccatccatacgctgtggcatgtgctggacgagatggattgcagttggctgccggtggtc
ggggactggcgcctcaacgagcgccactacggcgcgctgcagggcctgaacaaggccgac
atggcccggcaatacggcgccgatcaggtgctgctgtggcgccgcagttatgacaccccg
ccgccggcgcttgcggtctcggacccccgttgcgagcgcaacgatcgccgctacgccggt
gtgccggccgtgccgctgaccgaatgcctgaaagacaccgtggcccgtgtgctgccgttc
tggacgcaggtcatcgcgccggccatcgtttcgggcaagcgcgtggtgctggtggcccac
ggcaattcgatccgcgccctggtgaagtatctcgaccgcatcgccgaggccgacatcgtc
gggctgaacattcccaacgccattccactggtatacgagctcgacgccaacctcagcccg
atccgccactactatctgggcgatgccgatgcggcggcgcaggcagcggcggcggtagcg
gcgcagggccaagcgtaa

DBGET integrated database retrieval system