KEGG   Verminephrobacter eiseniae: Veis_0036Help
Entry
Veis_0036         CDS       T00460                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00010  Glycolysis / Gluconeogenesis
vei00260  Glycine, serine and threonine metabolism
vei00680  Methane metabolism
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
vei01230  Biosynthesis of amino acids
Module
vei_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_0036
  Energy metabolism
   00680 Methane metabolism
    Veis_0036
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Veis_0036
Enzymes [BR:vei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Veis_0036
Membrane trafficking [BR:vei04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Veis_0036
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Veis_0036
  Exosomal proteins of melanoma cells
   Veis_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM55829
JGI: Veis0036
UniProt: A1WDX2
Position
complement(48218..48955)
Genome map
AA seq 245 aa AA seqDB search
MHQLVLIRHGESTWNLENRFTGWTDVPLTPTGVSQALSAGRLLKAEGYMFDLACTSVLQR
AIHTLWHVLDEMDCSWLPVVGDWRLNERHYGALQGLNKADMARQYGADQVLLWRRSYDTP
PPALAVSDPRCERNDRRYAGVPAVPLTECLKDTVARVLPFWTQVIAPAIVSGKRVVLVAH
GNSIRALVKYLDRIAEADIVGLNIPNAIPLVYELDANLSPIRHYYLGDADAAAQAAAAVA
AQGQA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaactcgtcctgatccgccacggcgaatccacctggaacctcgaaaaccgcttc
accggctggaccgatgtccccctgacgcccaccggcgtgtcccaggccctgtcggcgggg
cggctgctcaaggccgagggctacatgttcgatctggcgtgcaccagtgtgttgcagcgc
gccatccatacgctgtggcatgtgctggacgagatggattgcagttggctgccggtggtc
ggggactggcgcctcaacgagcgccactacggcgcgctgcagggcctgaacaaggccgac
atggcccggcaatacggcgccgatcaggtgctgctgtggcgccgcagttatgacaccccg
ccgccggcgcttgcggtctcggacccccgttgcgagcgcaacgatcgccgctacgccggt
gtgccggccgtgccgctgaccgaatgcctgaaagacaccgtggcccgtgtgctgccgttc
tggacgcaggtcatcgcgccggccatcgtttcgggcaagcgcgtggtgctggtggcccac
ggcaattcgatccgcgccctggtgaagtatctcgaccgcatcgccgaggccgacatcgtc
gggctgaacattcccaacgccattccactggtatacgagctcgacgccaacctcagcccg
atccgccactactatctgggcgatgccgatgcggcggcgcaggcagcggcggcggtagcg
gcgcagggccaagcgtaa

DBGET integrated database retrieval system