KEGG   Verminephrobacter eiseniae: Veis_0208Help
Entry
Veis_0208         CDS       T00460                                 

Definition
(GenBank) histidinol dehydrogenase (EC:1.1.1.23)
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
vei  Verminephrobacter eiseniae
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Veis_0208
  Amino acid metabolism
   00340 Histidine metabolism
    Veis_0208
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Veis_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(227379..228758)
Genome map
AA seq 459 aa AA seqDB search
MTHRIDHGFKAMKSINLIELSKLSPQQRKSLMLRTESDLSTYANAVLPIIEDVRNRGDAA
LVHYAAQFEGAAIGLDSIRVSPAEFDAAFAMLDPKVVAAIEYGIENIRSFHTAQKPVQYW
MKELRPGAFAGERITPIDTVALYVPRGKGSFPSTVMMLCVPAVVAQVPTAYILTPAGPDG
RVDAATLVAARLAGIETIFKVGGSQAVAAAAFGTSTIPKADKILGPGSPWVMAAKRALVD
HLDPGIPAGPSESIVFADASADARLAALDVLIEAEHGPDSSAFLVTTSRAIASAAIDWIA
HFWNEMSARRVEFSATVLTGPRGGVLLADSVPSAMDFINDYAPEHLEILGAEPFGYLHQI
RNAGEILLGHATPMSIANFVLGPNAVLPTSFGAKTVSALSVHDFIKRTSIGYVTTKAFPP
MAAMGRELAIYEGFDAHALALAPQRFDPPVARTQPMAAE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcggatagaccacggattcaaggccatgaaatcgatcaacctcatcgaactg
tcgaaactctccccgcagcagagaaaatccctgatgctgcgcacggaaagcgacctgtcc
acctatgccaatgcggtattgcccatcatcgaagatgtcagaaaccgaggcgatgcggcc
ctggtgcattacgcagcgcaattcgagggcgcagcgatcgggttggactccatccgggta
tcccctgccgagttcgacgccgcgttcgccatgctcgaccccaaggtcgtggccgccatc
gaatacggcatcgagaacatccgctcgtttcatacggcccaaaagccggttcagtactgg
atgaaagaactgcgtcccggtgcatttgccggcgaacggatcacccccatcgatacggtc
gccctgtatgtgccgcgcggcaaaggctcatttcccagcaccgtgatgatgctgtgtgtt
ccggccgtggtggcccaagtcccgacggcctacatcctgacccccgccggacccgatggc
cgggtcgacgccgccaccctggttgccgcccggctcgccggtatcgaaaccatcttcaaa
gtcggcggctcgcaagcggttgcggctgcggcttttggcacctcgaccatccccaaggca
gacaagatactgggcccgggcagcccatgggtcatggcggccaagcgggcgctggtcgac
cacctggacccgggcatccccgcagggccgagtgaatcgatcgtgtttgccgacgcctct
gccgacgcccgtctggcggcactcgatgtgttgatcgaagccgagcatggcccggattca
tccgcatttctggtgaccaccagcagggccattgcatccgcagccatcgattggatagcg
catttctggaacgaaatgagcgcccggcgcgtcgagttctcggcaacggtattgaccggc
ccgcgcggcggcgtcttgttggccgattcagtgcccagcgcgatggacttcatcaacgac
tacgcgccggaacacctcgaaatcctcggcgcagaaccattcgggtatctccaccagatc
cgcaacgccggcgagatactgttgggccatgccacacccatgtcgatcgccaacttcgta
ctggggccgaacgcggttctgccgacatcattcggggccaaaaccgtgtccgccttgtcg
gtgcatgatttcatcaaacgcacatcgataggctacgtcaccaccaaggcatttcccccc
atggcagccatggggcgcgaattggccatttacgagggattcgacgcgcatgcactggcg
cttgcgccgcagcggttcgatccccccgtggcccggacgcaaccaatggctgccgaatga

DBGET integrated database retrieval system