KEGG   Verminephrobacter eiseniae: Veis_0334Help
Entry
Veis_0334         CDS       T00460                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vei  Verminephrobacter eiseniae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Veis_0334
Enzymes [BR:vei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Veis_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
378523..379443
Genome map
AA seq 306 aa AA seqDB search
MPRFGGLATMMRLPSVDDPAALDVGFVGVPLDLGTSHRSGTRFGPRQIRAESVLLRPYQM
ATRAAPFDALRVADLGDVAINPYNLIDSIARIERAFDAIVAAGCRPITLGGDHTITLPIL
RALHRRHGPIGLIHIDAHADVNDTMFGEKLAHGTTFRRAQEEGLLDPLRVAQIGLRGTGY
TAQDFDWCRDQGFRVVQVEECWGRSLMPLMQELRARVGGGPVYFTLDIDGIDPAYAPGTG
TPEIAGLTVPQTLELIRGAWGLNLVGADVVEVSPPYDPLGNTALLAANLAFELLCVMPGV
PRRTCA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccccggtttggcggcctggcgacgatgatgcgcctgccgtcggtcgacgatccggcg
gcgctggatgtcggcttcgtcggggtgcccctcgatctgggcacatcccatcgatccggc
acccgtttcggcccgcgccagatccgcgccgagtcggtgctgctgcggccgtaccagatg
gcgacccgggcggcgcccttcgatgcgttgcgcgtggccgacctcggcgacgtggcgatc
aacccctacaacctgatcgactcgatcgcgcgcatcgagcgcgccttcgatgccatcgtg
gcggccggctgcaggccgatcacgctgggcggcgaccacacgatcacgctgccgatcctg
cgcgcgctgcacaggcggcatggcccgatcgggctgatccacatcgacgcgcacgccgat
gtcaacgacaccatgttcggcgaaaaactggcgcatggcacgacctttcgccgcgcgcag
gaggaggggctgctggatccgctgcgggtggcgcagatcggtctgcgcggcacgggctac
acggcgcaggacttcgattggtgccgcgaccaggggtttcgtgtggtgcaggtggaggaa
tgctggggccgatcgctgatgccgttgatgcaggaactgcgcgcgcgggtcggtggcggc
ccggtgtacttcacgctcgacatcgatggcatcgacccggcctatgcccccggcaccgga
accccggagatcgcggggctgaccgtgccgcagacgctggagctgatccgcggcgcctgg
gggttgaacctggtgggcgcggatgtggtggaggtgtccccgccctacgacccgcttggc
aacaccgcattgctggccgccaacctggctttcgagttgctgtgcgtgatgcccggcgtc
cccaggcgcacctgcgcgtag

DBGET integrated database retrieval system