KEGG   Verminephrobacter eiseniae: Veis_0388Help
Entry
Veis_0388         CDS       T00460                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vei  Verminephrobacter eiseniae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Veis_0388
Enzymes [BR:vei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Veis_0388
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Veis_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
435656..436732
Genome map
AA seq 358 aa AA seqDB search
MPEHEGQAAPALRAGDFRQNFPMPVQSPAPFPQSRPRRLRRDAFTRALVREHALAPQDLI
YPVFVHEGQNQRQAVASMPGVDRLSLDLLLPVAEDCLRLGIVVLALFPVIAPALKTPDAR
EALNPEGLIARVVRALKKELPELGLMTDVALDPYTSHGQDGVLGPAGDIINDDTVALLTR
QALTHAEAGVDIIAPSDMMDGRIGAIREALEVQGHIHTRIMAYSAKYASAFYGPFRDAVG
SRSALGQADKNTYQMDPGNSDEALREVAIDIAEGADMVMVKPGMPYLDIVRRVKDEFRMP
TFVYQVSGEYAMIKAAAANGWLDHDAVMMECLLACKRAGADGVLSYFARDAARLLLKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcatgaggggcaggcagcaccggcgctgcgcgctggtgacttcaggcaaaat
ttccccatgcctgtccaaagccccgccccctttccgcaaagccgcccgcgccggctgcgc
cgtgacgccttcacccgcgcgctggtgcgcgaacatgcgctcgcgccgcaggatctgatc
tatcccgtgttcgtgcacgagggccaaaaccagcgccaggccgttgcgtccatgcccggc
gtcgatcggctgagcctggatttgttgctgcccgtggccgaggactgcctgcggctgggc
attgtcgtgctggcgctgtttcccgtcatcgccccggccctgaagacgcccgatgccagg
gaggcgctgaaccccgagggcctgattgcgcgcgtggtgcgcgcgttgaagaaggagttg
cccgaactcggcctgatgaccgatgtggcgctcgacccttacaccagccacggccaggac
ggcgttctcggcccggccggggacatcatcaacgacgacacggtggcgctgctgacgcgc
caggccctgacccatgccgaggccggcgtggacatcatcgcccccagcgacatgatggac
gggcgcatcggcgcgatccgcgaggcgctggaggtgcagggccacatccacacccgcatc
atggcctacagcgccaagtacgccagcgccttctacggccctttccgcgacgccgtcggc
tcgcgcagcgcgctcggccaggccgacaaaaacacctaccagatggaccccggcaacagc
gacgaggccctgcgcgaggtggccatcgacatcgccgaaggcgccgacatggtgatggtc
aagcccggtatgccgtacctggacatcgtgcgccgcgtgaaggacgagttccgcatgccc
accttcgtctaccaggtcagcggcgagtacgcgatgatcaaggccgccgccgccaatggc
tggctcgaccacgacgcagtgatgatggaatgcctgctggcctgcaaacgcgcaggcgcc
gacggggtgctgagctactttgcccgcgatgcggcaagattgctcctcaaaagatag

DBGET integrated database retrieval system