KEGG   Verminephrobacter eiseniae: Veis_0463Help
Entry
Veis_0463         CDS       T00460                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vei  Verminephrobacter eiseniae
Brite
Enzymes [BR:vei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Veis_0463
Secretion system [BR:vei02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Veis_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(531228..531968)
Genome map
AA seq 246 aa AA seqDB search
MKLTTALLTTAAAITLALSLSANAQEAQIRQALAERFPKLEKIDEVRATPLVGLYEVRIG
TDLYYTDAKGDYVLHGNLIDAKSRRNLTQERVNKLLAVDFSTLPLKDAVTIVRGDGRRRL
AIFEDPNCGYCKLLERSLQQVNDITVYLFLYPILNDDSTQKSRNIWCAKDKAGAWQDQML
RNKPAAAADCDTSALQRNLAFGAKHKITGTPTMIFANGSRVPGALDAQEVEKRLAEAAGG
KSPSTP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaccaccgccttgctgaccaccgccgctgccatcaccctggccctgagcctg
agcgccaacgcgcaggaagcgcaaatccgccaagcgcttgccgagcgctttccgaagttg
gagaagatcgatgaagtgcgggccaccccgttggtcgggctgtacgaggtgcgcatcggc
accgacctgtactacaccgacgccaagggcgactatgtgcttcatggcaatctgatcgat
gccaagtcgcggcgcaatctgacacaagagcgcgtcaacaaactgctggcggtggatttt
tccaccctgccgctcaaggatgcggtgaccatcgtgcgcggcgacggcagacgccggtta
gcgattttcgaagaccccaattgcggctactgcaagctcttggaacgcagcctgcagcag
gtgaacgacatcaccgtgtaccttttcctgtacccgatcctgaacgacgattcgacgcag
aagtcgcgcaacatctggtgcgccaaggacaaggccggcgcctggcaagaccagatgctg
cgcaacaaacccgccgctgcggccgattgcgacaccagtgccttgcagcgcaacctggca
ttcggggcaaagcacaaaatcaccggcacgcccacgatgatcttcgccaatggcagccgc
gtgccgggagcgcttgacgcacaggaagtggaaaagcgcctggccgaggcggccggcggc
aaatccccaagcaccccctga

DBGET integrated database retrieval system