KEGG   Verminephrobacter eiseniae: Veis_0598Help
Entry
Veis_0598         CDS       T00460                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Veis_0598
   00565 Ether lipid metabolism
    Veis_0598
   00590 Arachidonic acid metabolism
    Veis_0598
   00591 Linoleic acid metabolism
    Veis_0598
   00592 alpha-Linolenic acid metabolism
    Veis_0598
Enzymes [BR:vei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Veis_0598
    3.1.1.32  phospholipase A1
     Veis_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(665663..666928)
Genome map
AA seq 421 aa AA seqDB search
MPQPPAAHTTPHAGGLALTPVARPLVPSLASAALLLAALAPAGAALAQTMPAATGADSSA
WRRCSALSGNDPARLACFDAWAAQQDWQAPGASADSADGSSDNSDHSARSARPASALPVD
SPPPHPGSSDSAHAGCRDPQYSDLARFWELESGSDCGIFNFRGYRPITVSIVVASGVNRQ
PLSSAEGNSATTSIPYRHTENRIQLSVRTKLAQDLLTQNWPTLRDSLWFGYTQQSYWQLF
TPDISRPFRTTDHEPELIYVYPSTAQLPLGWRWRYSGIGLVHQSNGQSKPLSRSWNRVYL
MTGIELDRRWSVNARIWERIPESADSDDNPGISDYIGRAELSAFWNLNQYNTLGATVRHT
LSRSNRGSVRLEWLQALGAVRWGSKSSLRLHTALFRGHGDSVIDYNYKRTVFSLGLSLVD
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaccgccagcagcccacacgaccccccatgccggtggcctggcgctgacaccc
gtggcgcggcccctggtgccgtccctggccagcgccgcgctgctgctggccgcgctggcc
ccggcaggcgccgcgctggcgcagaccatgcccgcagccacaggggccgacagcagcgcc
tggcgccgctgcagcgcgctgtccggcaacgacccggcacgcctggcctgctttgacgca
tgggccgcgcagcaggactggcaggcgcccggcgcctccgccgacagtgcagatggcagt
tcagataattcagaccattcggcgcgttcggcccgcccggcatccgccctgcccgtggac
agcccgccgccgcaccccggcagcagcgacagcgcgcacgccggctgccgcgacccgcag
tacagcgacctggcgcggttctgggaactggagtcgggcagcgactgcggcatcttcaac
ttccgtggctaccggccgatcaccgtgtcgatcgtggtagcgagcggcgtgaaccgccag
cccctgtcgagcgccgagggcaactcggccaccacatccatcccctaccgccacaccgaa
aaccggatccagctctcggtgcgcaccaagctggcccaagacctgctcacccagaactgg
cccacgctcagggactcgctgtggttcggctacacccagcagtcgtactggcaactgttc
acgcccgacatctcgcgcccctttcgcaccaccgaccacgaacccgaactgatctacgtc
tacccgagcacggcgcagctaccgcttggctggcgctggcgctacagcggcattggactg
gtgcaccagtccaatggccagagcaagcccctgtcgcgcagttggaaccgggtctacctg
atgaccggcatcgagttggaccggcgctggagcgtcaacgcccgcatctgggagcgcatc
ccggaaagcgcggacagcgatgacaaccccggcatcagcgactacatcggccgcgccgag
ctgtcggcattctggaacctgaaccagtacaacacgcttggcgccacggtgcgccatacg
ctgtcccgcagcaaccgcggatcggtgcgcctggaatggttgcaggccctgggcgcggtc
cggtggggcagcaaaagcagcctgcgcttgcacaccgccctgtttcgtggccatggcgac
agcgtgatcgactacaactacaagcgcaccgtgttcagcctgggattgagcctggttgat
ttctga

DBGET integrated database retrieval system