KEGG   Verminephrobacter eiseniae: Veis_0965Help
Entry
Veis_0965         CDS       T00460                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vei01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vei00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1078440..1079465
Genome map
AA seq 341 aa AA seqDB search
MHANAPSPHPATAGPIPRPAHRPIALIGAPTDIGAGVRGASMGPEALRVAGLQAALQGHG
LQSFDRGNLSGPANPWQAPVQGYRHLPEVVQWNQRVFDAVSAELRLGHLPILLGGDHCLG
LGSISAVARHCAARGQPLRVLWLDAHADFNTSALTPSGNLHGMPMACLCGLGPGPLTQLA
GGMPGGGPALRAQQIRLIGVRSVDPGEKRLVHQQGLEVFDMRYIDEAGMRQTMQQALAGL
DADCHLHVSFDVDFLDPDIAPGVGTPVPGGPGYREAQLCMEMIADSGRLASLDIVELNPA
LDLRNRTALLAVDLVESLFGKSTLMRVPPPEIGTALVAARV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccaacgcaccatctccccaccccgccacggccggccccatcccccgccccgcc
catcgcccgatagcgctgatcggcgcccccaccgatatcggggccggggtgcgcggcgca
tccatggggccggaggctctgcgcgtggccgggctgcaggcggcgctgcaagggcatggc
ctgcaatcgttcgaccggggcaatctgagcggcccggccaatccttggcaagcgccggtg
cagggctatcgccatctgcccgaggtggtgcagtggaatcagcgcgtgttcgatgcggta
tcggccgagttgcgtctgggtcatctgccgatcttgctcggcggtgaccattgcctgggg
ctgggcagcatcagcgccgtggcgcgccattgcgccgcgcggggccagccgctgcgtgtg
ctgtggctcgacgcccatgccgacttcaacaccagcgccctgacgcccagcggcaatctg
catggcatgccgatggcctgcctgtgcggcttggggcctgggccgctgacgcagttggcc
ggcggcatgcccggcggcgggccggcattgcgtgcgcagcagattcgcctgatcggcgtc
cgcagcgtagatccgggcgaaaagcgcctggtccatcagcagggcctggaggtcttcgac
atgcgctacatcgatgaagccggcatgcgccagaccatgcagcaggctttggcggggctg
gacgccgattgccacctgcatgtcagtttcgatgtggattttctggacccggacatcgcc
cccggtgtcggcacaccggtgcccggcggccccggttaccgtgaggcgcaactgtgcatg
gaaatgattgccgacagcggccggctggcgtcgctggatatcgtggagctcaacccggcg
ctcgatctgcgcaaccggacggcgctgctggcggtggacctggtggagtcgctgtttggc
aagagcacgttgatgcgcgtgccgccgccagagatcggtacggctctggtggcggccagg
gtttag

DBGET integrated database retrieval system