KEGG   Verminephrobacter eiseniae: Veis_1286Help
Entry
Veis_1286         CDS       T00460                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Veis_1286
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Veis_1286
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Veis_1286
Enzymes [BR:vei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Veis_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1422101..1423513)
Genome map
AA seq 470 aa AA seqDB search
MIDGKKIRAPLHRWKSTMNQPTRFVLDEPRLPRVWYNLAADLPQPVPAMLHPGTRQPIQA
SDLAPLFPPAIIGQELSVEREIPIPDAVRDVYRLWRPSPLIRAHRLEQALDTPARIYYKN
EGVSPSGSHKPNSAVPQAWYNKQAGIKRLTTETGAGQWGASLAFAGQLFGLDVTVFQVRI
SYDQKPYRRALMETYGARCLASPSTETGFGRSVLSRAPDHLGSLGIAISEAVEAAVATPD
TRYALGSVLNHVLLHQTIVGQEALMQMEMAGDDPDVIVACTGGGSNFAGLVFPFLGLQLR
GGRARRYVAAEPMACPSLTRGRYAYDFGDTAGITPLAKMHTLGSGFTPPGLHAGGLRYHG
MAPLVSHLRELGLIEAMAYHQTECFGAGRLFARCEGIIPAPEANHAIACTIQEALRCKRE
GRAETILFNLSGHGHFDMSAYQDFNAQQLTDKTYDETELATALAGLPSVS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatggcaagaaaatccgagcaccacttcatcgatggaagagcaccatgaaccag
cccacccgcttcgttcttgacgaacccaggctgccccgcgtttggtacaaccttgctgcg
gacttgccgcagcctgtgcctgcgatgcttcatcccggcacacgccagcctatacaggcc
agcgacctcgcaccgctgtttccgcctgcgatcatcgggcaggagttgtcggtcgagcgg
gaaattccgattcccgacgcggtgcgtgacgtgtatcgcctgtggcgcccgtcgccgctc
attcgcgcgcaccggctggagcaggcgctcgatacgccggcgcgcatctactacaagaat
gaaggcgtatcgccgtccgggtcgcacaagccaaattccgccgtgccgcaagcctggtac
aacaagcaggccggcatcaaacggttgaccacggaaacaggcgcaggccaatggggggcg
tctctcgctttcgccgggcagcttttcggactggacgttaccgtctttcaggtgcgcatc
tcatacgatcaaaaaccgtaccgcagagcgctgatggaaacctacggcgcgcgctgcctg
gcgtcgccatcgacagaaaccgggtttggccgctccgtactgtccagagctcccgatcac
ctcggctcgctgggtatcgcgatctccgaggccgtcgaggccgccgtggcaacacccgac
acgcgctatgcgctcggctcggtcttgaaccatgtgctgcttcatcaaacgatcgttggg
caggaggcgctgatgcaaatggaaatggcgggcgacgaccccgacgtgatcgtcgcgtgc
accggcggcgggtccaatttcgccggtctggtgtttccgtttcttggcttgcaattgcgc
ggcgggcgggcgcgccgctacgttgcggcggaacccatggcgtgtccgtcgctgacacgc
gggcgctatgcgtatgacttcggcgatacagccggcatcacgccgctggcgaagatgcac
acgctgggatcgggctttacgccgccgggacttcatgcgggcgggctgcgctatcacggc
atggcgccgttggtgtcgcatctgcgcgagttgggcctcatcgaagcaatggcctaccat
caaaccgaatgcttcggcgctggccggctgtttgcgcgctgcgaaggcatcatcccggca
ccggaagccaaccatgcgattgcttgcaccattcaggaagcgttgcgctgcaagcgcgag
gggcgggcggagaccattttgttcaatctgtcgggacacggccacttcgacatgagcgcg
tatcaggatttcaacgcgcagcaattgaccgacaagacttacgatgaaaccgaactggcg
acggcgctcgccggcctgccatccgtttcctga

DBGET integrated database retrieval system