KEGG   Verminephrobacter eiseniae: Veis_1329Help
Entry
Veis_1329         CDS       T00460                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vei  Verminephrobacter eiseniae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Veis_1329
Enzymes [BR:vei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Veis_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1474348..1475151
Genome map
AA seq 267 aa AA seqDB search
MTYDWLAPGAKTIAPVRGPFTGTMRAMSSPPAGAMAPLPPDPGSPVSVKIRERLVAARKR
FHANDNIAQFIEPGELAQLLDEVEVKIEGMLDSLVIDTEDDHNTRHTARRMAKMYLNEVF
KGRYVPAPPITEFPNVERLNELMIVGPLTVRSACSHHFCPVVGRIWIGVLPSEHTNVIGL
SKYARLVDWIMGRPQIQEEAVVQLADLIMEKTQPDGLAIMMEASHFCMSWRGVREMDSKM
INSVMRGVFLKDSALRREFLALLPGRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatgattggcttgcacccggggcgaaaaccattgcgcctgtgcgcgggccgttc
actggtacgatgcgggccatgagcagtccacccgcaggcgccatggcgcccctcccgccg
gacccaggcagtccggtttccgtcaaaatccgcgagcggctcgtcgcagcgcgcaagcgc
tttcacgccaacgacaacattgcccagttcatcgagcctggcgagctggcgcagttgctc
gatgaagtcgaggtcaagatcgagggcatgctcgacagcctggtcatcgacaccgaggac
gaccacaacacccgccacactgcgcgccgcatggccaagatgtacctcaacgaggtgttc
aagggccgctatgtgccggcgccgccgatcaccgagtttcccaacgtcgagcggctgaac
gaactcatgatcgtcgggccgctgacggtgcgcagtgcctgcagccaccatttttgcccc
gtggtcggcaggatctggatcggcgtgctgcccagcgagcacaccaacgtgatcggcctg
tccaagtacgcgcggctggtggactggatcatgggccgcccgcagatccaggaagaagcc
gtggtgcaactggccgacctgatcatggagaaaacccagcccgacgggctggcgatcatg
atggaggccagccacttttgcatgtcctggcgcggtgtgcgcgaaatggacagcaagatg
atcaactcggtgatgcgcggcgtgttcctcaaggacagcgcgctgcgccgtgaattcctc
gccctgctccctggcaggaattga

DBGET integrated database retrieval system