KEGG   Verminephrobacter eiseniae: Veis_1601Help
Entry
Veis_1601         CDS       T00460                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
vei  Verminephrobacter eiseniae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Veis_1601
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Veis_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1785741..1786118
Genome map
AA seq 125 aa AA seqDB search
MKMEHVRRAALVAAVIVPGLPAAAQDVNAGRQVFAQCAACHAVTTANGVGPGLWGIVGSK
SASVPGFRYGAAIKRAHLIWDEKNLDAYIADPQKALPGTLMPFSGIADAQQRADLIAYLK
TIKSP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggaacatgttcgtcgggcggcgttggttgccgccgtcatcgtgccgggcctg
ccggcagcggcgcaagatgtcaacgcaggccggcaggtcttcgcgcaatgcgccgcttgc
catgccgtcaccactgccaacggcgtcggtcccggcctgtggggcattgtcggcagcaag
tcggcgtcggtgccgggctttcgttatggcgcggcgatcaagcgcgcccatctgatctgg
gatgaaaagaatctggatgcctatatcgccgacccgcagaaagcgctgccgggaacgctg
atgccattttcgggcattgccgatgcacagcaacgcgccgatctgattgcatacctgaaa
acgatcaagtcaccgtag

DBGET integrated database retrieval system