KEGG   Verminephrobacter eiseniae: Veis_1635Help
Entry
Veis_1635         CDS       T00460                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vei  Verminephrobacter eiseniae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vei01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vei00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vei00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1819374..1821602
Genome map
AA seq 742 aa AA seqDB search
MTDHTTVCGLQVATPLLRFIEDRVLPGTGVDSAAFWQGFAAIVVDLAPRNLALLAERERL
QTALDAWHQANPGPIGDMAAYRSFLEKIGYLLPPIAQVQASTTGVDDELATQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIPDTGATAKGRGYNPVRGAKVIAFARQVLDEHV
PLASGAHRDATGYRVADGQLLVALPGGASTGLAHPGQFKGYQGNAASPSSVLLQHNGLHL
DIRIDRSTPIGQTDAAGVSDLVLEAALSTILDLEDSVAAVDARDKLLGYSNWLGIIQGTL
TEQLTKDGRSFTRGLNPDRIYTGPRGGTVRLHGRSLMFLRNVGHLMTNPAIRYTDAQGRQ
REIPEGIMDAVVTTAIALHDLRKVHGAGAAQIRNSRQGSVYIVKPKMHGPVEVGFANELF
GRVEQLLGLPAHTVKLGIMDEERRTSVNLKACIAAASARVAFINTGFLDRTGDEIHTAMH
AGAMVRKGDMKASAWIQAYEKNNVLVGLACGLRGKAQIGKGMWAMPDLMADMLRQKIAHP
QAGANTAWVPSPTGATLHALHYHQVKVSEVQIALEKIDANAEHDNLLAGLLTVPVAAQAN
WSEAEKQQELDNNVQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWL
LHGVVTPAQVRATFERMAAVVDRQNAGDPLYQPMAGHFETSLAYQAACDLVFKGLAQPSG
YTEPLLHAWRQQRKAAPAAPAA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaccaccgtttgcggcctgcaagtggccacacccctgctgcgctttatc
gaagaccgggtgctgcccggcacgggcgtcgacagcgctgcgttctggcagggctttgcg
gccatcgtggtcgacctggcaccgcgcaacctggcgctgctggccgagcgcgagcgcttg
cagactgcgctggacgcttggcaccaggccaaccccgggccgatcggagacatggcggct
taccgcagtttcctcgaaaagatcggctacctgctgccccccatcgcccaggtgcaggcc
agcaccaccggtgtcgacgacgaactggccacgcaggccgggccgcagttggtggtgccg
atactgaacgcgcgctatgcgctcaatgccgccaatgcgcgctggggcagcctgtatgac
gcgctgtacggcaccgatgtcatccccgacaccggcgccaccgccaagggccggggctac
aaccccgtgcgcggcgccaaggtgattgcctttgcgcgccaggtgctcgatgagcatgtg
ccgctggccagcggcgcgcaccgggatgcgaccggctaccgcgtggccgacgggcagttg
ctggtggcgctgccgggcggcgccagcaccggcctggcacaccccggccagttcaaaggc
taccagggcaacgccgccagcccgtcgtcggtgctgctgcagcacaacggcctgcacctg
gacatccggatcgaccgcagcaccccgatcggccagaccgatgcggcgggcgtgagcgac
ctggtgctcgaagcggccctgtcgaccatcctggacctggaagactccgtggccgccgtc
gatgcccgggacaagctgctgggctacagcaactggctgggcatcatccagggcacgttg
accgagcagttgaccaaggatggccgcagcttcacccgcggcctgaaccccgaccgcatc
tacaccggcccccggggcggcacagtgcggctgcatgggcgctcgctgatgttcctgcgc
aatgtgggccatctgatgaccaacccggccatccggtacaccgacgcccagggccggcag
cgcgagattcccgaaggcatcatggacgccgtggtcaccaccgccatcgccttgcatgac
ctgcgcaaagtccatggcgcaggcgctgcgcagatccgcaattcacgccagggcagcgtc
tacatcgtcaagcccaagatgcacggcccggtcgaggtgggctttgccaacgagctgttc
ggccgcgtcgagcaattgctggggctgccggcgcacaccgtcaagctgggcatcatggac
gaagagcgccgcaccagcgtgaacctcaaagcctgcattgctgcggccagcgcgcgcgtg
gccttcatcaacaccggttttctggaccgcaccggcgacgagatacacaccgcgatgcac
gcgggcgcgatggtgcgcaagggcgacatgaaggccagcgcctggatccaggcctacgaa
aagaacaatgtgctggtgggcctggcctgcggcctgcgcggcaaggcgcagatcggcaag
ggcatgtgggccatgcccgacctgatggccgacatgctccggcagaaaatcgcccatccc
caggccggcgccaacaccgcctgggtgcccagcccgaccggcgccacgctgcacgcgctg
cactaccaccaggtgaaggtcagcgaggtgcagatcgcgctggagaagatcgacgccaac
gccgagcacgacaatctgctggccggcctgctcacggtgccggtggccgcccaagcgaac
tggagcgaggccgaaaagcagcaggaactggacaacaacgtccagggcattctgggctat
gtggtgcgctgggtggaccagggcgtgggctgctccaaggtgcccgacatccacaacgtg
ggcctgatggaagaccgcgccacgctgcgcatcagcagccagcacattgccaattggctg
ctccatggcgtggtcacgccagcccaggtgcgcgccaccttcgagcgcatggcggcggtg
gtggaccggcaaaacgccggcgacccgctgtaccagccgatggccggtcacttcgagacc
agcctggcctaccaggcggcctgcgatctggtcttcaagggcctggcccagcccagcggc
tataccgaaccgctgctgcatgcctggcgccagcagcgcaaggcggccccggcagcgcca
gccgcctga

DBGET integrated database retrieval system