KEGG   Verminephrobacter eiseniae: Veis_1635Help
Entry
Veis_1635         CDS       T00460                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vei  Verminephrobacter eiseniae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Veis_1635
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Veis_1635
   00630 Glyoxylate and dicarboxylate metabolism
    Veis_1635
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Veis_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1819374..1821602
Genome map
AA seq 742 aa AA seqDB search
MTDHTTVCGLQVATPLLRFIEDRVLPGTGVDSAAFWQGFAAIVVDLAPRNLALLAERERL
QTALDAWHQANPGPIGDMAAYRSFLEKIGYLLPPIAQVQASTTGVDDELATQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIPDTGATAKGRGYNPVRGAKVIAFARQVLDEHV
PLASGAHRDATGYRVADGQLLVALPGGASTGLAHPGQFKGYQGNAASPSSVLLQHNGLHL
DIRIDRSTPIGQTDAAGVSDLVLEAALSTILDLEDSVAAVDARDKLLGYSNWLGIIQGTL
TEQLTKDGRSFTRGLNPDRIYTGPRGGTVRLHGRSLMFLRNVGHLMTNPAIRYTDAQGRQ
REIPEGIMDAVVTTAIALHDLRKVHGAGAAQIRNSRQGSVYIVKPKMHGPVEVGFANELF
GRVEQLLGLPAHTVKLGIMDEERRTSVNLKACIAAASARVAFINTGFLDRTGDEIHTAMH
AGAMVRKGDMKASAWIQAYEKNNVLVGLACGLRGKAQIGKGMWAMPDLMADMLRQKIAHP
QAGANTAWVPSPTGATLHALHYHQVKVSEVQIALEKIDANAEHDNLLAGLLTVPVAAQAN
WSEAEKQQELDNNVQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWL
LHGVVTPAQVRATFERMAAVVDRQNAGDPLYQPMAGHFETSLAYQAACDLVFKGLAQPSG
YTEPLLHAWRQQRKAAPAAPAA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaccaccgtttgcggcctgcaagtggccacacccctgctgcgctttatc
gaagaccgggtgctgcccggcacgggcgtcgacagcgctgcgttctggcagggctttgcg
gccatcgtggtcgacctggcaccgcgcaacctggcgctgctggccgagcgcgagcgcttg
cagactgcgctggacgcttggcaccaggccaaccccgggccgatcggagacatggcggct
taccgcagtttcctcgaaaagatcggctacctgctgccccccatcgcccaggtgcaggcc
agcaccaccggtgtcgacgacgaactggccacgcaggccgggccgcagttggtggtgccg
atactgaacgcgcgctatgcgctcaatgccgccaatgcgcgctggggcagcctgtatgac
gcgctgtacggcaccgatgtcatccccgacaccggcgccaccgccaagggccggggctac
aaccccgtgcgcggcgccaaggtgattgcctttgcgcgccaggtgctcgatgagcatgtg
ccgctggccagcggcgcgcaccgggatgcgaccggctaccgcgtggccgacgggcagttg
ctggtggcgctgccgggcggcgccagcaccggcctggcacaccccggccagttcaaaggc
taccagggcaacgccgccagcccgtcgtcggtgctgctgcagcacaacggcctgcacctg
gacatccggatcgaccgcagcaccccgatcggccagaccgatgcggcgggcgtgagcgac
ctggtgctcgaagcggccctgtcgaccatcctggacctggaagactccgtggccgccgtc
gatgcccgggacaagctgctgggctacagcaactggctgggcatcatccagggcacgttg
accgagcagttgaccaaggatggccgcagcttcacccgcggcctgaaccccgaccgcatc
tacaccggcccccggggcggcacagtgcggctgcatgggcgctcgctgatgttcctgcgc
aatgtgggccatctgatgaccaacccggccatccggtacaccgacgcccagggccggcag
cgcgagattcccgaaggcatcatggacgccgtggtcaccaccgccatcgccttgcatgac
ctgcgcaaagtccatggcgcaggcgctgcgcagatccgcaattcacgccagggcagcgtc
tacatcgtcaagcccaagatgcacggcccggtcgaggtgggctttgccaacgagctgttc
ggccgcgtcgagcaattgctggggctgccggcgcacaccgtcaagctgggcatcatggac
gaagagcgccgcaccagcgtgaacctcaaagcctgcattgctgcggccagcgcgcgcgtg
gccttcatcaacaccggttttctggaccgcaccggcgacgagatacacaccgcgatgcac
gcgggcgcgatggtgcgcaagggcgacatgaaggccagcgcctggatccaggcctacgaa
aagaacaatgtgctggtgggcctggcctgcggcctgcgcggcaaggcgcagatcggcaag
ggcatgtgggccatgcccgacctgatggccgacatgctccggcagaaaatcgcccatccc
caggccggcgccaacaccgcctgggtgcccagcccgaccggcgccacgctgcacgcgctg
cactaccaccaggtgaaggtcagcgaggtgcagatcgcgctggagaagatcgacgccaac
gccgagcacgacaatctgctggccggcctgctcacggtgccggtggccgcccaagcgaac
tggagcgaggccgaaaagcagcaggaactggacaacaacgtccagggcattctgggctat
gtggtgcgctgggtggaccagggcgtgggctgctccaaggtgcccgacatccacaacgtg
ggcctgatggaagaccgcgccacgctgcgcatcagcagccagcacattgccaattggctg
ctccatggcgtggtcacgccagcccaggtgcgcgccaccttcgagcgcatggcggcggtg
gtggaccggcaaaacgccggcgacccgctgtaccagccgatggccggtcacttcgagacc
agcctggcctaccaggcggcctgcgatctggtcttcaagggcctggcccagcccagcggc
tataccgaaccgctgctgcatgcctggcgccagcagcgcaaggcggccccggcagcgcca
gccgcctga

DBGET integrated database retrieval system