KEGG   Verminephrobacter eiseniae: Veis_1783Help
Entry
Veis_1783         CDS       T00460                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00010  Glycolysis / Gluconeogenesis
vei00052  Galactose metabolism
vei00500  Starch and sucrose metabolism
vei00520  Amino sugar and nucleotide sugar metabolism
vei00521  Streptomycin biosynthesis
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_1783
   00052 Galactose metabolism
    Veis_1783
   00500 Starch and sucrose metabolism
    Veis_1783
   00520 Amino sugar and nucleotide sugar metabolism
    Veis_1783
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Veis_1783
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Veis_1783
Enzymes [BR:vei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Veis_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABM57537
JGI: Veis1783
UniProt: A1WIT0
Position
1990501..1991514
Genome map
AA seq 337 aa AA seqDB search
MNPLRLLADIGGTNIRLAWQDQPGGPLHDTRVLPCANYPTVAAAITAYLAEQGLATPREA
ALGMANPVTGDAVRMTNHSWSFSQRALRAQLGLQRLLVLNDFTALALALPLLRPEQLRQV
GGGAAVAGSAVVLIGPGTGLGVSGLVFPPGSHGGVPLSGEGGHVSLAAQTQQEFDVLRIL
QARYGHASAERAVCGAGLVDLYQALRQLAPSNPSGPSGGPSGPLGASDPSTAAQVTERAL
QGSDPIALQALEMFCGFLGSVAGNLALTLGAHGGVYIGGGMVPRLGTWFDRSTFRPRFEA
KGRFQTYLAAIPCWIIDPGATPALHGAARALDIAGSA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacccactgcgcctgttggccgacatcggcggcaccaatatccgcctggcctggcaa
gaccagcccggcggcccgttgcatgacacccgcgtgttgccctgcgccaactaccccacg
gtggcggccgccatcaccgcctatctggccgagcagggtctggccaccccgcgcgaggcg
gccttgggcatggccaacccggtgactggcgatgcggtgcgcatgaccaaccacagttgg
agtttttcgcagcgtgcgttgcgcgcgcaactgggcctgcagcggctgctggtgctcaac
gacttcaccgcgctggcgctggcgctgcccttgctcaggcccgaacaactgcgccaagtc
ggcggcggcgcggcggtggccggcagcgcggtcgtgctgatcgggccgggcacggggctg
ggggtgtcgggcctggtgtttccgcccggctcccacggcggcgtgccgctgtccggcgag
ggcgggcatgtgagcctggccgcacagacgcagcaggagtttgacgtgctgcgcatcctg
caagcgcggtacggccatgcctccgccgagcgcgccgtgtgcggtgccgggctggtcgat
ctgtaccaggctttgcgccaattggctccatcgaacccgtcaggcccatcaggaggtcca
tcgggcccgttgggcgcgagcgacccgagcacggccgcgcaggtcaccgagcgggcattg
caaggcagcgaccccattgccttgcaggcgctggagatgttctgcggctttctcggcagc
gtggccggcaacctggcgctgacgctgggcgcacatggcggggtctacatcggcggcggc
atggtgccgcgcctggggacatggtttgatcgctcgacctttcgcccccgctttgaggcc
aaggggcgctttcagacctacctggccgcgattccatgctggatcatcgaccccggcgcc
acgcccgcgctgcatggcgcagcgcgggcgctggatatcgcgggcagtgcgtaa

DBGET integrated database retrieval system