KEGG   Verminephrobacter eiseniae: Veis_2019Help
Entry
Veis_2019         CDS       T00460                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
vei  Verminephrobacter eiseniae
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vei00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2295390..2296100
Genome map
AA seq 236 aa AA seqDB search
MTSMTSTPPTSSTDENRLRAAIVQHCQRLSGAGLSAGTSGNISARCAQGASAGLLISPSG
VDYADLRPESLVWMDLDGRWSGPLKPSSEWRFHRDIYVARPEAGAIVHAHPTHATALAVQ
RLAIPAFHYMVAAAGGHDIRCARYATYGTEELSQHALAALEGRRACLLANHGMIAFGADL
RRAFALAIEVETLAHQYLLARATGTPVILEAQEMDRVLEKFKSYGVNAQTAPSAAA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacatccatgacatccacgccacccacgtcatctaccgacgagaaccggctgcgcgcc
gccatcgtgcagcactgccagcggctgtctggcgccggcttgtccgccggcacgtcgggc
aatatcagcgcgcgctgcgcgcaaggcgccagcgccggcctgctgatcagcccgagcggc
gtggactatgccgatctgcgccccgagtcgctggtctggatggacctggacgggcgctgg
agcgggccgctcaagcccagttcggaatggcgctttcaccgcgacatctacgtcgcccgg
cccgaggccggcgccatcgtccatgcccacccgacacatgccaccgcgctggccgtgcag
cgcctggcgataccggcctttcactacatggtggccgccgccggcgggcatgacatccgc
tgcgcgcgctatgccacctacggcaccgaggagttgtcgcagcacgcgctggccgcgctc
gaaggccgccgcgcctgcctgctggccaaccacgggatgatcgccttcggcgccgacctg
cggcgcgcattcgcgctggccatcgaggtcgagacgctggcgcaccaatatctgctggcg
cgcgccaccggcacgccggtgatcctggaggcgcaggaaatggaccgggtgctggaaaag
ttcaagtcctacggcgtcaacgcccaaactgccccctcagccgccgcgtga

DBGET integrated database retrieval system