KEGG   Verminephrobacter eiseniae: Veis_2130Help
Entry
Veis_2130         CDS       T00460                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vei  Verminephrobacter eiseniae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Veis_2130
Enzymes [BR:vei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Veis_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2421567..2422535)
Genome map
AA seq 322 aa AA seqDB search
MTTPCTRRPRIAVVGSLNIDLVLQVRHAPGPGETVLADALHLLPGGKGGNQAVACVRQGA
QVQMFGRIGDDAHGRILRARLDADGIDHSGVQTDPNADTGMAAITVDAAAQNRIVVVPGA
NGRFMLDTDALRASLRQAHCLVMQFEIPLPQVLAAAGQAQAAGCPVLLNPSPMAPLPALQ
ALPGALWPLVDTLVVNEVEAAALAGSAVATPADAAVAAQTLCALGPDRVVVTLGAAGAVA
ADAAGCRHHPGQMVAAVDTTAAGDTFLGALAVALAQQQALDAAVRQGIRAATLCVLQAGA
QPSIPTRAAVAQSPQPPDWIRL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgtgcacccgccgcccgcgcatcgccgtcgtcggcagcctgaacatcgac
ctggtgctgcaagtgcgccatgccccaggccctggcgaaaccgtgctcgccgacgcgctg
cacctgctgcccggcggcaagggcggcaaccaggccgtggcctgcgtccgccagggcgcg
caggtgcagatgtttggccgcatcggcgacgacgcccatggccgcatcctgcgcgccagg
ctcgatgccgacggcatagaccacagcggcgtgcagaccgacccgaacgcggacaccggc
atggccgcgatcacggtcgacgcggcggcgcaaaaccgcatcgtcgtggtgcccggcgcc
aacggccgcttcatgctcgacaccgacgcactgcgcgccagcctgcgccaggcgcattgc
ctggtcatgcagttcgagattccgctgccccaggtgctggccgccgcaggccaggcgcag
gcagcgggctgcccggtgctgctcaacccctcgccgatggcgccgttgccggcattgcaa
gccctgcccggggcgctgtggccgctggtggacacgctggtcgtcaacgaagtggaggcc
gccgccctggcaggcagcgccgtcgccaccccggccgatgcggccgtggcggcgcaaacg
ctgtgcgcgctggggccggatcgggtggtggtcacgctgggcgcggcaggcgcagtggcc
gccgatgccgccggctgccgccaccacccgggccaaatggtcgcagccgtcgacaccacg
gctgccggcgacacctttctcggcgcactcgccgtggcgctggcgcagcagcaagcgctc
gacgcggccgtgcgccaaggcatacgggccgccaccctgtgcgtgttgcaggccggcgcc
cagccctccattccgacccgcgccgccgtagcgcaaagcccgcagccgccggactggatt
cggctgtga

DBGET integrated database retrieval system