KEGG   Verminephrobacter eiseniae: Veis_2324Help
Entry
Veis_2324         CDS       T00460                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Veis_2324
Enzymes [BR:vei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Veis_2324
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Veis_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2626891..2628426
Genome map
AA seq 511 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDEHGRIVAQAQLELPQIYPRPGWVEHDPLEIWRSQLATARA
ALAKAGIAANAVRAVGIANQRETTVLWNRKTGQPVHHAIVWQDRRAEPACAQLREQGHAG
AIQAKTGLLIDAYFSGSKLQWLLDHVPGAREAAERGELAFGTVDSWLIWKLTHGQRHLTD
VSNAARTMLLNVHTNQWDDDLLALLRIPRALMPEVLPSSADFGDTAADLLGHGIRIGGVA
GDQQSALFGQACFTAGMAKNTYGTGCFMLMHLGARFQTSDNGLLTTSAAQLAPKPGAGSG
QAEPALAQRAYAMEGSVFIGGAVVQWLRDGLRAITSSAGIEALAHSVPDAGGVMMVPAFT
GLGAPYWKPEARGSITGLTRGSTLAHIARAALESIAYQSAALLQAMGRDAVAAGGAPVSE
LRVDGGACINDLLMQFQADLLGIPVLRPAVIETTALGAAYLAGLSSDLYHSTDELAQLWR
AERRFEPRLDRARAQELMAHWEHAVRQATAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgccctcgaccaaggcacctccagttcccgcagcatcgtcttcgac
gaacacggccgcatcgtggcccaggcccaattggagctgccccagatctacccccggccc
ggctgggtggagcacgacccgctggagatctggcgcagccaactggccaccgcgcgcgcg
gcgctcgccaaggcgggcatcgccgccaacgccgtgcgcgccgtgggcatcgccaaccag
cgcgagaccacggtgctctggaaccgcaagaccggccagcccgtgcaccacgccatcgtg
tggcaggaccgccgcgccgagcccgcctgcgcccaactgcgcgagcagggccacgcgggc
gccatacaggccaagaccgggctgctgatcgacgcgtacttctcgggcagcaagctgcaa
tggctgctggaccatgtgcccggtgcgcgcgaagccgccgagcgcggcgagttggccttc
ggcacggtggacagttggctcatatggaagctcacccacggccagcggcatctgaccgac
gtgagcaacgcagcgcgcaccatgctcttgaacgtgcacaccaaccagtgggacgacgat
ctgctggccctgctgcgcattccccgggcgctgatgcccgaggtgctgccgtcgagcgcc
gattttggcgacaccgccgccgatctgctcggccacggcatacgcatcggcggcgtggcg
ggcgaccagcaaagcgcgctgttcggccaggcctgctttaccgccggcatggccaagaac
acctacggcacgggctgcttcatgctgatgcacctgggcgccagattccagacctcggac
aacggcctgttgaccaccagcgccgcgcaactggcgcccaagcctggcgctggctccggg
caggccgagccggcgcttgcgcagcgggcctatgcgatggagggcagcgtcttcatcggc
ggtgccgtggtgcagtggctgcgcgacggcctgcgcgccatcaccagcagcgccgggatc
gaagcgctggcgcacagcgtgcccgacgccggcggcgtgatgatggtgccggccttcacc
ggcctgggcgcaccgtactggaagcccgaggcgcgcggcagcattaccggcctgacgcgc
ggcagcacgctggcccatattgcacgcgccgcgctggagagcatcgcctaccaaagcgcc
gccctgctgcaggccatgggccgtgatgccgtggccgccggtggcgcgccggtgagcgag
ttgcgcgtcgacggcggcgcctgcatcaatgacctgctgatgcagttccaggccgacctg
ctgggcattccggtgttgcgccctgcggtcatagaaaccaccgcgctgggcgcggcctac
ttggccggactgtccagcgacctgtaccacagcaccgacgagttggcgcaactgtggcgc
gctgagcgccgcttcgagccccgcctggaccgtgcccgcgcgcaggagttgatggcgcac
tgggaacatgcggtgcgccaagccacagcgcgctga

DBGET integrated database retrieval system