KEGG   Verminephrobacter eiseniae: Veis_2346Help
Entry
Veis_2346         CDS       T00460                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vei  Verminephrobacter eiseniae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vei00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:vei00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2648601..2649686
Genome map
AA seq 361 aa AA seqDB search
MTGHAPLILDLEGKELGAAERRRLAHPLTGGVILFARNWENRAQLLQLTRAIEAVRADLL
ICVDHEGGRVQRFCGDGFTRLPAMRTLGAMWMDDGRGAPGSGALRATNAATAIGHVLGAE
LRACGVDLSFTPVLDLAWGRSSVIGDRALHRDPRVVALLAKSLMHGLLQVGMAHCGKHFP
GHGFARADSHTGLPVDRRSLRAILADDAAPYQWLSSTLASVMPAHVLYPRVDSRPAGFSQ
RWLQDILRRQLRFAGAIFSDDLGMEGARCIDGRRVSHTDAAIAALDAGCDLVLLCNQGQG
LAVDELIAGLEQAQARGRWQPSLVSESRRLALRPATRAPDWDALMHQRAYRQARSALEVH
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactggacatgcacccctgatcctcgacctggagggcaaagaactcggcgccgccgag
cggcgccgcctggcccacccgctgaccggcggggtgatcctgtttgcccgcaactgggaa
aaccgcgcgcaactgctgcaattgacccgcgccatcgaggccgtgcgcgccgatctgttg
atctgcgtggaccatgaaggcgggcgtgtgcagcgcttttgcggcgatggctttacccgg
ttgccggcgatgcgcaccctgggggcgatgtggatggatgacggccggggcgcccccggc
agcggcgcgctgcgtgccaccaatgccgcgacggccatcggccatgtgctgggtgccgaa
ctgcgcgcctgcggcgtggacttgagtttcacgccggtgctcgatctggcctggggccgc
agcagcgtgatcggcgaccgcgccttgcaccgcgacccgcgcgttgtcgcgctgctggcc
aagagcctgatgcacggactgctgcaggtcggcatggcccattgcggcaagcattttccg
gggcatggttttgcccgggccgactcgcacaccgggctgccggtagaccggcgcagcctg
cgggccatcctggccgacgatgccgcgccgtaccagtggctgagcagcacgctcgccagc
gtgatgcccgcgcatgtgctctacccccgggtcgacagccgccccgccggtttttcgcag
cgctggctgcaagacattttgcgccgccaactgcgctttgccggcgcgatcttcagcgac
gacctgggcatggaaggcgcgcgctgcatcgacggtcgacgggtcagccataccgacgcc
gccatcgctgcgttggacgcgggctgtgacctggtgctgctgtgcaatcagggccagggc
ctggccgtggatgaattgatcgccggcctggagcaggcccaggcccgaggccgctggcag
cccagcctggtcagcgagtcgcgccgcctggccctgcggcccgccacccgggcgccagac
tgggacgcgctgatgcatcagcgcgcgtaccggcaggcacggtctgcgctggaggtgcat
gattga

DBGET integrated database retrieval system