KEGG   Verminephrobacter eiseniae: Veis_2350Help
Entry
Veis_2350         CDS       T00460                                 

Definition
type 11 methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vei  Verminephrobacter eiseniae
Brite
Enzymes [BR:vei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Veis_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2655464..2656177
Genome map
AA seq 237 aa AA seqDB search
MNLPLNTSANPSDPVAQARYNMIEQQIRPWNVLDASVLELLAVVRREHFVPAAYRSLAFM
DIEIPLLGSNAEQALRLGHSMLAPRVEARMLQDLQIAPTDRVLEIGAGSGYMAALLARRA
AHVLALEIVPALADMARTNLRQAGIGNADVRQADGASDALAEGPFDVIVLSGSVAELPGA
LLSALREGGRLGAIVGMEPMMRFTVARRQGERLDTRSPWDANAPRLVNFPEPSGFTF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcccctgaacacatccgccaaccccagcgacccggtggcccaggcccgctac
aacatgatcgagcagcagatccgcccctggaacgtgctcgacgccagcgtcctggaactg
ctggccgtggtgcgccgcgagcacttcgtgcctgccgcctaccgcagcctggcattcatg
gacattgaaatcccgctgctgggcagcaacgccgagcaagccctgcgcctgggccacagc
atgttggcgccccgcgtcgaggcgcgcatgttgcaggacctgcaaattgcgcccaccgac
cgcgtgctcgaaatcggtgccggctccggctacatggccgccttgctggcccggcgcgca
gcgcatgtgctggcgctggaaatcgttccggcactggccgacatggcccgcaccaatctg
cgccaggccggcatcggcaacgccgatgtgcgccaggccgacggcgccagcgacgcgctg
gccgagggcccgttcgacgtgatcgtgctcagcggctcggtggccgaactgcccggcgcg
ctgctgtctgcgctgcgcgagggcggccgcttgggcgccatcgtcgggatggagccgatg
atgcgtttcaccgtggcccggcgccagggcgagcgcctggacacccgctcgccttgggac
gccaacgcgccgcgcctggtcaactttcccgagccttccggcttcaccttctga

DBGET integrated database retrieval system