KEGG   Verminephrobacter eiseniae: Veis_2461Help
Entry
Veis_2461         CDS       T00460                                 

Definition
class II aldolase/adducin-like protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
vei  Verminephrobacter eiseniae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Veis_2461
Enzymes [BR:vei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Veis_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2795870..2796763
Genome map
AA seq 297 aa AA seqDB search
MNQRPESPDGDERQARAEICRVGRRLFGRGDGHASAGNIGVRLADDCLITPTDACPGTPA
PERLARFDARGRQLSGARASKAIALHRHLCAVCAASASTAAPACCVIHTHSTSLVSRHRS
DVVGCAQPSERSARRSAQPIPSVLASDATPRCAPMASADRQMIGDSTRVSCSLPSDAAAD
GPLAPDAQLRAPITPCFVMKLGRVPPIPYHRPGAPEAAKAVAQTTARDTPPGRPIRAVML
ARLAPNVWHDNPAAAMAALEAREETARPWLPCQPRHAPTPPTGPRIAELRQTFGAHR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcgcccggaatcaccggacggcgacgaacggcaagcccgggcggagatctgc
cgtgtgggccgccgcctgttcgggcgcggcgacgggcacgccagcgccggcaacatcggc
gtgcggctggccgatgactgcctgatcacgcccaccgacgcctgcccgggcacgcccgcg
cccgagcgcctggcccggttcgatgcccggggccggcaactgtctggcgctcgcgccagc
aaggccattgcgctgcaccgccacctctgcgccgtctgcgccgcgtcggccagcaccgcc
gcgcctgcgtgctgcgtcatccatacccacagcacaagcctggtgtcgcgtcatcggtca
gatgtcgtaggctgcgcgcagccatcggagcgcagcgccaggcgcagcgcgcagcccata
ccgagcgtattggcaagcgatgcaacgccgcgatgcgctccgatggccagcgcagaccga
cagatgatcggtgactcgacacgggtgtcctgctcgttgccaagcgatgcggcggcagac
gggccgctggcgccggatgcgcaactgcgcgcgccgatcacgccctgcttcgtgatgaag
ctgggccgcgtgccccctattccctatcaccgcccgggcgcgcccgaggccgccaaggcg
gtggcgcagaccaccgcgcgcgacacgcccccaggccgcccgatccgggccgtgatgctg
gcgcgcctggcgcccaatgtctggcacgacaaccccgccgccgcgatggccgcgctcgaa
gcacgggaagaaaccgcgcgcccgtggctgccgtgccagccccgccatgccccgaccccg
ccgaccgggccgcgcattgcagaactgcgccagacctttggcgcccatcggtaa

DBGET integrated database retrieval system