KEGG   Verminephrobacter eiseniae: Veis_2546Help
Entry
Veis_2546         CDS       T00460                                 

Definition
acyl transferase domain-containing protein
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
vei  Verminephrobacter eiseniae
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Veis_2546
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Veis_2546
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     Veis_2546
Lipid biosynthesis proteins [BR:vei01004]
 Fatty acid synthase
  Component type
   Veis_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2876946..2877893
Genome map
AA seq 315 aa AA seqDB search
MFTGQGAQRVGMGSDVDEAAKSKAVWDCACDISGFDVRRMCWKGPMGKLSETRYQQVAVT
AVNLASYYALKASRLLPEDSVFIGHSVGEYSALHASGALDLEQTFKAVNARAIGMQTQAE
QTKGAMYAVKGGSIVQVNDVIDAMGLHGQVVIANDNSPLQVVIAGNSGIVKQVGAELSGR
RLPTVRLAVNGAWHSPLMAGMLPEYGSLLRSLDIRMPSSQILMNRSAQEPLSPQEIRDNL
TYHVVETVRWRETVEKLLQRNKARFLEVGPRKVLCALVSDCGSLGSQAQTTHCSQMLRSL
PSHLPAPRLQEAPAC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttcactggccaaggggcccagcgggtcgggatgggttcggacgtggatgaagcagcg
aaaagcaaggcggtctgggactgtgcttgcgacatctccgggttcgacgtccgccgcatg
tgctggaaaggcccgatgggcaagctctcggagacccggtaccagcaagtcgcggtgacc
gcagtcaacctcgcgagctactacgcactgaaggcttcacgcctgctgccggaggactcg
gtcttcatcggccacagcgtcggcgagtactcggcactacacgcaagcggggcgctcgac
ttggagcagaccttcaaggccgtgaacgcacgcgcgatcggcatgcagacgcaggccgag
cagaccaagggggcgatgtatgcggtcaagggcggctcgatcgttcaggtcaacgacgtc
atcgacgctatggggttgcacgggcaagtagtgatcgccaatgacaactcgccactccaa
gtggtcatcgcgggcaactcgggcattgtgaagcaggtgggcgcggagctctcggggcgt
cgcctcccgacagtcaggctcgcggtgaatggcgcctggcatagcccgctgatggccggg
atgctgccggaatacggcagcctgctgaggagcctggacatcaggatgccttcgtcgcag
attcttatgaaccgctcggcgcaggagccgctgtccccgcaagagatccgggacaacctg
acttaccatgtcgtggagacggtccggtggcgggagaccgtcgagaaactgcttcagcgc
aacaaggcccgcttcctggaggtggggccgcgcaaggtgctttgcgcgctagtgtcagat
tgcggcagcctgggctcccaggcgcagactacccattgcagccagatgctgaggagcttg
cccagtcacctgcccgcgccacgcttgcaagaggcccccgcatgctga

DBGET integrated database retrieval system