KEGG   Verminephrobacter eiseniae: Veis_2664Help
Entry
Veis_2664         CDS       T00460                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Veis_2664
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Veis_2664
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Veis_2664
Enzymes [BR:vei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Veis_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3006941..3008491
Genome map
AA seq 516 aa AA seqDB search
MKYISTRGQAGRRPFCDILLEGLAPDGGLYLPEHYPQIDDAALTRLRQVWHEQGYAELAY
QLLSLYIDDIPAADLRALCAKTYIAEVFGSRSIVPLRPLEAGLWLQALSNGPTLAFKDLA
MQLLGHLFEYELARRGEQLNILGATSGDTGSAAEYALRGKTGVRVFMTSPDGRMSAFQQA
QMFSLQDANIHNLAIDGVFDDCQDIVKAVSRDQTFKRRHRIGTINSINWARLLAQVVYYF
AGYLQASASNAQQVSFTVPSGNFGNVCAGHVARMMGLPIDRLVVATNENDVLDEFFRTGV
YRVRSSADTRATSSPSMDISKASNFERFVFDLLGRDGARVETLFGQTLATRGRIDLSGDP
RFAEAATRYGFASGKSTHADRLATIRDNHQRHRVTLDPHTADGVKVAREHLAQRARERPA
QDPPAAPMIVLETALPIKFAATIIEALGQAPERPAQFAGIENLPRRVQRLPADAQQVKAY
IERHCTADADAGAKPQAPGASSAGRDDCHAPMGSDG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacccgtggccaggcagggcgcagaccgttttgcgacatcctgctc
gagggcctggcccccgacggcggcctgtacctgcccgagcattacccgcagatcgatgac
gcagccctgacgcgcttgcgccaggtctggcacgagcagggctacgccgaactggcatac
cagttgctgtcgctgtacatcgacgacattcccgccgccgacctgcgggcgctgtgcgcc
aagacctacatcgccgaagtcttcggcagccgctccatcgtgccgctgcgcccgctcgaa
gccggcctgtggctgcaagcactgtccaacggcccgacgctggccttcaaggacctggcc
atgcagttgctgggccatttgttcgagtacgaactggcgcgccgtggcgagcaactgaac
atcctgggcgccaccagcggcgacaccggcagtgcggccgaatacgcgctgcgcggcaag
accggcgtgcgcgtattcatgaccagcccggatggccgcatgagcgccttccagcaggcg
cagatgttcagcctgcaagacgccaacatccacaacctggccatcgacggcgtgttcgac
gactgccaggacatcgtcaaggccgtcagccgcgaccagaccttcaagcgcaggcaccgg
atcggcaccatcaactccatcaactgggcgcgcctgctggcgcaggtggtgtactacttt
gccggctacctgcaagccagcgcaagcaacgcgcagcaggtcagcttcacggtgcccagc
ggcaacttcggcaatgtctgcgccggccatgtggcgcgcatgatgggcctgcccatcgac
cggctggtggtggccaccaacgagaacgatgtgctcgacgaattctttcgcaccggcgtc
taccgcgtgcgcagcagcgccgatacgcgcgccacctccagcccctcgatggacatcagc
aaagccagcaacttcgagcgcttcgtgttcgacctgctcggccgcgacggcgcgcgcgtc
gagacgctgttcggccagaccctggccacccggggccggatcgacctgagcggcgacccg
cgctttgccgaagccgcaacgcgctacggttttgccagcggcaagagcacccatgccgac
cggctggcgaccatccgcgacaaccaccagcgccatcgcgtcacgctggacccccacacc
gccgacggggtgaaggtggcgcgcgagcacttggcgcagagggcgcgcgagcgcccggcg
caagacccgcccgcagcgccgatgatcgtgctggagacggcgctgccgatcaagttcgcc
gcgaccatcatcgaagccctgggccaggcgcccgagagacccgcgcagttcgccggcatc
gaaaacctgccccggcgcgtgcagcggctgcctgccgatgcgcaacaggtcaaagcctat
atcgagcgccactgcacggcggatgcggatgcgggcgccaaaccgcaggcgccgggcgcc
agcagcgccgggcgcgatgactgccatgcccccatggggagcgatggatga

DBGET integrated database retrieval system