KEGG   Verminephrobacter eiseniae: Veis_2730Help
Entry
Veis_2730         CDS       T00460                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00020  Citrate cycle (TCA cycle)
vei00640  Propanoate metabolism
vei00660  C5-Branched dibasic acid metabolism
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
Module
vei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Veis_2730
   00640 Propanoate metabolism
    Veis_2730
   00660 C5-Branched dibasic acid metabolism
    Veis_2730
Enzymes [BR:vei01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Veis_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABM58472
JGI: Veis2730
UniProt: A1WLG5
Position
complement(3075531..3076697)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKDILRQFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
QLAKTIDEVRRLAGSMLGMQLKTHQTGPEGQKVRRLYIEEGADIGKEYYLSIVTDRATQK
LAFIASSEGGMDIEEVKRAKPEMIITEFVDPLAGLGPEQALKIAVGIGLPAPAQAQAQAV
DIMRRLYQCYMDTDASLLEINPLNCDGQNRLTALDAKFNFDANALWRHPEIVAYRDFEEE
DPAEVLASKFDLAYISMDGNIGCLVNGAGLAMATMDTIKLFGGAPANFLDVGGGATAEKV
TEAFKIMLGNPKVKGILVNIFGGIMRCDTIATGVISACKAVNLSVPLVVRMKGTNEEPGK
KLLAESGLPIIAADTMADAAQRIVAAVR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaataccaaggcaaggacatcttgcgccaattcggtgtgcccgttccg
cgcggcattcccgccttcacggtgcaagaagccgtggaagcagcccagaagctcggcggc
ccggtgtgggtcgtgaaggcccagattcacgccggtggccgcggcaagggcggcggcgtg
caactggcaaaaaccatcgacgaggtcaggcgcctggccggctccatgctgggcatgcag
ctcaagacgcaccagaccggccccgagggccagaaggttcgccgcctgtacatcgaagaa
ggcgccgacatcggcaaggaatactacctgtcgatcgtgaccgaccgcgccacgcaaaag
ctggccttcatcgcttcgagcgagggcggcatggacatcgaggaggtcaagcgcgccaag
ccggagatgatcatcaccgaattcgtcgatccgctggcgggcctgggcccggagcaggcg
ctcaagatcgccgtcggcatcggcctgcccgcgccagcccaggcccaggcccaggccgtg
gacatcatgcgccggctctaccagtgctacatggacaccgacgcatcgctgctggagatc
aacccgctgaactgcgacggccaaaaccggctgaccgcgctcgacgccaagttcaacttc
gacgccaacgcgctgtggcgccaccccgagatcgtggcctaccgcgatttcgaggaagaa
gacccggccgaagtgctggcctcgaagttcgacctggcctacatcagcatggacggcaac
atcggctgcctggtcaacggcgccggcctggccatggccacgatggacaccatcaagctg
ttcggcggcgcgccggccaacttcctggacgtgggcggtggcgccacggcagagaaggtc
accgaagccttcaagatcatgctcggcaaccccaaggtcaaaggcatcctggtcaacatc
ttcggcggcatcatgcgctgcgacaccatcgccaccggcgtgatcagcgcctgcaaggcc
gtgaacctgtccgtgccgctggtcgtgcgcatgaagggcaccaacgaagagccgggcaag
aaactgctggccgagtccggcctgccgatcatcgccgcagacaccatggccgacgccgcg
cagcgcatcgtggccgccgttcgataa

DBGET integrated database retrieval system