KEGG   Verminephrobacter eiseniae: Veis_2815Help
Entry
Veis_2815         CDS       T00460                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Veis_2815 (tpiA)
   01230 Biosynthesis of amino acids
    Veis_2815 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_2815 (tpiA)
   00051 Fructose and mannose metabolism
    Veis_2815 (tpiA)
   00562 Inositol phosphate metabolism
    Veis_2815 (tpiA)
Enzymes [BR:vei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Veis_2815 (tpiA)
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Veis_2815 (tpiA)
  Exosomal proteins of bladder cancer cells
   Veis_2815 (tpiA)
  Exosomal proteins of melanoma cells
   Veis_2815 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3162984..3163796)
Genome map
AA seq 270 aa AA seqDB search
MAMTMNDRKKLIVGNWKMNGSLAANQDLLQAIRAGIADLDAAACTVALAVPAPYLAQVQA
LVAGSALALAAQDLSPHEAGAYTGEVSAAMLKDFGVRYALVGHSERRQYHGETDALVAKK
VQRALAAGLTPIVCLGETLPEREAGQTEAVVRRQLAAVIQLNGHCISEVVLAYEPVWAIG
TGRTASARQAQAVHAVLRAQLGAASSHAGRIRLLYGGSMNAANAAPLLAQPDIDGGLVGG
AALKAPDFLQIIAAACADGGPAMESGVNRQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggccatgaccatgaacgacaggaaaaaactcatcgtcggcaactggaagatgaatggc
agcctggccgcgaaccaggacttgctgcaggccatccgcgccggcatcgccgacctggat
gctgccgcttgcactgtggcgctggccgtgcccgcgccttatctggcgcaggtgcaggcg
ttggtggccggctcggcgctggcgctggccgcgcaggatctgtcaccgcacgaggccggc
gcctataccggcgaggtgtcggcagccatgctcaaggactttggcgtgcgctatgcgctg
gtcgggcattccgagcggcgccagtaccacggtgaaaccgacgcgctggtggccaagaag
gtgcagcgcgcgctggcggcgggtctgacgcccatcgtctgcctgggcgagaccttgcca
gagcgtgaggccggccagaccgaggccgtggtccggcgccaactggcggcagtgatacag
ctcaacggccattgcatcagtgaggtggtgctggcgtatgagccggtctgggccatagga
acgggccgcacggcgtctgcacggcaagcgcaggcggtgcatgccgtgctgcgcgcgcaa
cttggcgctgccagcagccatgccgggcgcatccgtctgctgtacggcggcagcatgaac
gcggccaacgccgcgccattgctggcgcagcccgacatcgacggcgggctggtcggcggc
gcagcgctgaaggcgccggactttttgcaaatcatcgcggcggcctgcgcagacggcggg
ccagcgatggaatcaggggtgaacagacaatga

DBGET integrated database retrieval system