KEGG   Verminephrobacter eiseniae: Veis_3088Help
Entry
Veis_3088         CDS       T00460                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00630  Glyoxylate and dicarboxylate metabolism
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01200  Carbon metabolism
Module
vei_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Veis_3088
Enzymes [BR:vei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Veis_3088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM58821
JGI: Veis3088
UniProt: A1WMG4
Position
3437796..3439127
Genome map
AA seq 443 aa AA seqDB search
MPQSLNEQLSREQQIAALEKNWAQAPRWKGVKRGYGAADVVRLRGSLQPEHTLAQRGAEK
LWDKINGGAKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLY
AYDSVPAMVRRINNTFKRADEIQWGRGVNPGDKEFIDYFLPIVADAEAGFGGVLNAFELM
KNMISAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEACEKLIAARFAADVMGVSTIVLAR
TDAEAANLVTSDHDANDRPFLTGERTQEGFYRVKNGLEQAISRGVAYAPYADLVWCETGV
PDIGFAREFAQAVHAACPGKLLSYNCSPSFNWKKNLNDQQIASFQDELSALGYKFQFITL
AGIHINWFNTFEFAHAYARGEGMKHYTDMVQEPEFAAREKGYSFVSHQQEVGAGYFDDVT
TVIQGGSSSVKALTGSTEEQQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatccctgaacgaacaactcagccgcgagcagcaaatcgccgcgctggaaaaa
aattgggcccaggccccgcgctggaagggcgtcaagcgcggctacggcgccgctgatgtg
gtgcgcctgcgcggcagcttgcagccggagcacacgctggcccagcgcggtgcggaaaag
ctgtgggacaagatcaacggcggcgccaaaaagggctacgtgaacgcattcggcgccatc
tctgccgggcaggccatgcagcaagccaaggccggtctggaagccgtgtacctgtcgggc
tggcaagtggccgccgacggcaacacttcggaaaccatgtaccccgaccagtcgctgtac
gcctacgactcggtgcccgcgatggtccgccgcatcaacaacaccttcaagcgcgctgac
gaaattcagtggggccgtggcgtcaaccccggcgacaaggagttcatcgactatttcctg
cccatcgtggcagacgccgaggccggctttggcggcgtgctcaacgccttcgagttgatg
aagaacatgatcagcgccggcgctgccggtgttcacttcgaggaccagttggcggccgtg
aagaaatgcggccacatgggtggcaaggtgctggtgcccacgcaggaagcctgcgaaaag
ctgatcgcggcgcgctttgcggccgacgtgatgggcgtgtcgaccatcgtgctggcccgc
accgatgccgaagccgccaacctggtcacgtccgaccatgacgcgaacgacaggcccttt
ctgaccggcgaacgcacgcaggaaggcttttaccgcgtcaagaacgggctggagcaagcc
atcagccgtggcgtcgcctacgctccttacgccgacctggtgtggtgcgaaaccggtgtg
ccggacatcggctttgcccgtgaattcgcccaggctgtgcacgcagcatgcccgggcaag
ctgctgtcgtacaactgctcgccgtccttcaactggaagaagaacttgaacgaccagcag
atcgcctcctttcaggacgaactgtcggccctgggctacaagttccagttcatcacgctg
gccggcatccatatcaactggttcaacaccttcgagttcgcccatgcctacgcccgtggc
gaaggcatgaagcactacaccgatatggtgcaggagccggaattcgccgcccgcgaaaag
ggctacagcttcgtgtcgcaccagcaggaggtgggcgcaggctacttcgatgacgtgacc
accgtgatccagggcggctcctccagcgtgaaggcgctgaccggctcgaccgaagagcaa
cagttccactga

DBGET integrated database retrieval system